Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MPI Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Mannose phosphate isomerase

Gene Aliases

CDG1B; mannose-6-phosphate isomerase; phosphohexomutase; Phosphomannose isomerase; phosphomannose isomerase 1; PMI; PMI1.

Gene ID

4351

Accession Number

NP_001276085

Reactivity

Homo sapiens|Human

Target

Involved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions.

Type

Protein

Source

E.coli

Sequence

AAPRVFPLSCAVQQYAWGKMGSNSEVARLLASSDPLAQIAEDKPYAELWMGTHPRGDAKILDNRISQKTLSQWIAENQDSLGSKVKDTFNGNLPFLFKVLSVETPLSIQAHPNKELAEKLHLQAPQHYPDANHKPEMAIALTPFQGLCGFRPVEEIVTFLKKVPEFQFLIGDEAATHLKQTMSHDSQAVASSLQSCFSHLMKSEKKVVVEQLNLLVKRISQQAAAGNNMEDIFGELLLQLHQQYPGDIGCFAIYFLNLLTLKPGEAMFLEANVPHAYLKGDCVECMACSDNTVRAGLTPKFIDVPTLCEMLSYTPSSSKDRLFLPTRSQEDPYLSIYDPPVPDFTIMKTEVPGSVTEYKVLALDSASILLMVQGTVIASTPTTQTPIPLQRGGVLFIGANESVSLKLTEPKDLLIFRACCLL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

73.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MPI

Protein Name

Mannose-6-phosphate isomerase

Gene Name URL

MPI

Nucleotide Accession Number

NM_001289156

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)
MBS1432005-01 0.02 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)
MBS1432005-02 0.02 mg (Yeast)

Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)
MBS1432005-03 0.1 mg (E-Coli)

Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)
MBS1432005-04 0.1 mg (Yeast)

Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)
MBS1432005-05 0.02 mg (Baculovirus)

Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)

Sign In for Pricing
View Details
Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)
MBS1432005-06 0.02 mg (Mammalian-Cell)

Recombinant Oryza sativa subsp. japonica Mannan endo-1,4-beta-mannosidase 8 (MAN8)

Sign In for Pricing
View Details