What is the catalog number for MARCKSL1 Recombinant Protein (Human)?

The catalog number for MARCKSL1 Recombinant Protein (Human) is OPCA04920-20UG.

What sizes are available for MARCKSL1 Recombinant Protein (Human)?

MARCKSL1 Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is MARCKSL1 Recombinant Protein (Human) in stock?

MARCKSL1 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

MARCKSL1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

MARCKS like 1

Gene Aliases

F52; mac-MARCKS; MACMARCKS; macrophage myristoylated alanine-rich C kinase substrate; MARCKS-like protein 1; MARCKS-related protein; MLP; MLP1; MRP.

Gene ID

65108

Accession Number

NP_075385

Reactivity

Homo sapiens|Human

Target

Controls cell movement by regulating actin cytoskeleton homeostasis and filopodium and lamellipodium formation. When unphosphorylated, induces cell migration. When phosphorylated by MAPK8, induces actin bundles formation and stabilization, thereby reducing actin plasticity, hence restricting cell movement, including neuronal migration. May also affect cancer cell migration. May be involved in coupling the protein kinase C and calmodulin signal transduction systems (By similarity) .

Type

Protein

Source

E.coli

Sequence

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.