Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MARCKSL1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

MARCKS like 1

Gene Aliases

F52; mac-MARCKS; MACMARCKS; macrophage myristoylated alanine-rich C kinase substrate; MARCKS-like protein 1; MARCKS-related protein; MLP; MLP1; MRP.

Gene ID

65108

Accession Number

NP_075385

Reactivity

Homo sapiens|Human

Target

Controls cell movement by regulating actin cytoskeleton homeostasis and filopodium and lamellipodium formation. When unphosphorylated, induces cell migration. When phosphorylated by MAPK8, induces actin bundles formation and stabilization, thereby reducing actin plasticity, hence restricting cell movement, including neuronal migration. May also affect cancer cell migration. May be involved in coupling the protein kinase C and calmodulin signal transduction systems (By similarity) .

Type

Protein

Source

E.coli

Sequence

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

46.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MARCKSL1

Protein Name

MARCKS-related protein

Gene Name URL

MARCKSL1

Nucleotide Accession Number

NM_023009

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GBF1 Double Nickase Plasmid (h2)
sc-406558-NIC-2 20 µg

GBF1 Double Nickase Plasmid (h2)

Sign In for Pricing
View Details
Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1155892-01 0.02 mg (E-Coli)

Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details
Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1155892-02 0.1 mg (E-Coli)

Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details
Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1155892-03 0.02 mg (Yeast)

Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details
Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1155892-04 0.1 mg (Yeast)

Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details
Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit K, chloroplastic
MBS1155892-05 0.02 mg (Baculovirus)

Recombinant Phaseolus vulgaris NAD (P)H-quinone oxidoreductase subunit K, chloroplastic

Sign In for Pricing
View Details