Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LELP1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Late cornified envelope like proline rich 1

Gene Aliases

Late cornified envelope-like proline-rich protein 1; novel small proline rich protein; Novel small proline-rich protein.

Gene ID

149018

Accession Number

NP_001010857

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MSSDDKSKSNDPKTEPKNCDPKCEQKCESKCQPSCLKKLLQRCFEKCPWEKCPAPPKCLPCPSQSPSSCPPQPCTKPCPPKCPSSCPHACPPPCPPPE

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

37.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LELP1

Protein Name

Late cornified envelope-like proline-rich protein 1

Gene Name URL

LELP1

Nucleotide Accession Number

NM_001010857

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lrtm2 Polyclonal Antibody
CAC11638-01 50 µL

Lrtm2 Polyclonal Antibody

Sign In for Pricing
View Details
Lrtm2 Polyclonal Antibody
CAC11638-02 100 µL

Lrtm2 Polyclonal Antibody

Sign In for Pricing
View Details
CNNM3 Human Pre-designed siRNA Set A
HY-RS02897 1 Set

CNNM3 Human Pre-designed siRNA Set A

Sign In for Pricing
View Details
ELISA kit for Porcine OPN (Osteopontin)
E-EL-P0627 96 Tests

ELISA kit for Porcine OPN (Osteopontin)

Sign In for Pricing
View Details
EIF5A2 Knockout HGC-27 Polyclonal Cells
ARG41084 1 Million

EIF5A2 Knockout HGC-27 Polyclonal Cells

Sign In for Pricing
View Details
SLA (Src-like-adapter, Src-like-adapter Protein 1, SLAP, hSLAP, SLA1, SLAP1, SLAP-1) (MaxLight 650)
MBS6224660-01 0.1 mL

SLA (Src-like-adapter, Src-like-adapter Protein 1, SLAP, hSLAP, SLA1, SLAP1, SLAP-1) (MaxLight 650)

Sign In for Pricing
View Details