Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIMM8A Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Translocase of inner mitochondrial membrane 8A

Gene Aliases

DDP; DDP1; deafness dystonia protein 1; deafness/dystonia peptide; DFN1; mitochondrial import inner membrane translocase subunit Tim8 A; MTS; TIM8; translocase of inner mitochondrial membrane 8 homolog A; X-linked deafness dystonia protein.

Gene ID

1678

Accession Number

NP_004076

Reactivity

Homo sapiens|Human

Target

Mitochondrial intermembrane chaperone that participates in the import and insertion of some multi-pass transmembrane proteins into the mitochondrial inner membrane. Also required for the transfer of beta-barrel precursors from the TOM complex to the sorting and assembly machinery (SAM complex) of the outer membrane. Acts as a chaperone-like protein that protects the hydrophobic precursors from aggregation and guide them through the mitochondrial intermembrane space. The TIMM8-TIMM13 complex mediates the import of proteins such as TIMM23, SLC25A12/ARALAR1 and SLC25A13/ARALAR2, while the predominant TIMM9-TIMM10 70 kDa complex mediates the import of much more proteins. Probably necessary for normal neurologic development.

Type

Protein

Source

E.coli

Sequence

MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TIMM8A

Protein Name

Mitochondrial import inner membrane translocase subunit Tim8 A

Gene Name URL

TIMM8A

Nucleotide Accession Number

NM_004085

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmem91 (NM_177102) Mouse Tagged Lenti ORF Clone
MR201453L4 10 µg

Tmem91 (NM_177102) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Mouse Protein Wnt-10a ELISA Kit
MBS2881760-01 48 Well

Mouse Protein Wnt-10a ELISA Kit

Sign In for Pricing
View Details
Mouse Protein Wnt-10a ELISA Kit
MBS2881760-02 96 Well

Mouse Protein Wnt-10a ELISA Kit

Sign In for Pricing
View Details
Mouse Protein Wnt-10a ELISA Kit
MBS2881760-03 5x 96 Well

Mouse Protein Wnt-10a ELISA Kit

Sign In for Pricing
View Details
Mouse Protein Wnt-10a ELISA Kit
MBS2881760-04 10x 96 Well

Mouse Protein Wnt-10a ELISA Kit

Sign In for Pricing
View Details
Recombinant Influenza A virus (H1N1) HA/Hemagglutinin Protein, C-8His
EVV03823 100 μg

Recombinant Influenza A virus (H1N1) HA/Hemagglutinin Protein, C-8His

Sign In for Pricing
View Details