What is the catalog number for RAE1 Recombinant Protein (Human)?

The catalog number for RAE1 Recombinant Protein (Human) is OPCA04910-100UG.

What sizes are available for RAE1 Recombinant Protein (Human)?

RAE1 Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is RAE1 Recombinant Protein (Human) in stock?

RAE1 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

RAE1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ribonucleic acid export 1

Gene Aliases

DJ481F12.3; dJ800J21.1; Gle2; homolog of yeast Rae1 (Bharathi) mRNA-associated protein of 41 kDa (Kraemer) ; MIG14; migration-inducing gene 14; Mnrp41; mRNA export factor; mRNA export protein; mRNA-associated protein MRNP 41; mRNA-binding protein, 41-kD; MRNP41; rae1 protein homolog; RAE1 RNA export 1 homolog.

Gene ID

8480

Accession Number

NP_001015885

Reactivity

Homo sapiens|Human

Target

Plays a role in mitotic bipolar spindle formation (PubMed:17172455) . Binds mRNA. May function in nucleocytoplasmic transport and in directly or indirectly attaching cytoplasmic mRNPs to the cytoskeleton.

Type

Protein

Source

E.coli

Sequence

MSLFGTTSGFGTSGTSMFGSATTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAGSWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLSSNQAIQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIYPMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRVAIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFWDKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAEELKPRNKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.