Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CDKN2D Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cyclin dependent kinase inhibitor 2D

Gene Aliases

CDK inhibitor p19INK4d; cell cycle inhibitor, Nur77 associating protein; cyclin-dependent kinase 4 inhibitor D; cyclin-dependent kinase 4 inhibitor D p19; cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4) ; inhibitor of cyclin-dependent kinase 4d; INK4D; p19; p19-INK4D.

Gene ID

1032

Accession Number

NP_001791

Reactivity

Homo sapiens|Human

Target

Interacts strongly with CDK4 and CDK6 and inhibits them.

Type

Protein

Source

E.coli

Sequence

MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

44.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CDKN2D

Protein Name

Cyclin-dependent kinase 4 inhibitor D

Gene Name URL

CDKN2D

Nucleotide Accession Number

NM_001800

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

W/W012/NL494/PEUL-210X297-1 Electrical & Equipment Safety Signs & Labels (Adhesive)
324225 1 Label (1 Label (s) x 1 Pack)

W/W012/NL494/PEUL-210X297-1 Electrical & Equipment Safety Signs & Labels (Adhesive)

Sign In for Pricing
View Details
4-Aminobutyrate Aminotransferase (ABAT), Recombinant, Rat, His-Tag
051927-01 10 µg

4-Aminobutyrate Aminotransferase (ABAT), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
4-Aminobutyrate Aminotransferase (ABAT), Recombinant, Rat, His-Tag
051927-02 50 µg

4-Aminobutyrate Aminotransferase (ABAT), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
4-Aminobutyrate Aminotransferase (ABAT), Recombinant, Rat, His-Tag
051927-03 100 µg

4-Aminobutyrate Aminotransferase (ABAT), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
4-Aminobutyrate Aminotransferase (ABAT), Recombinant, Rat, His-Tag
051927-04 200 µg

4-Aminobutyrate Aminotransferase (ABAT), Recombinant, Rat, His-Tag

Sign In for Pricing
View Details
EHF ELISA Kit (Human) (OKCA00674)
OKCA00674 96 Well

EHF ELISA Kit (Human) (OKCA00674)

Sign In for Pricing
View Details