Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF14 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Fibroblast growth factor 14

Gene Aliases

FGF-14; FHF4; FHF-4; fibroblast growth factor 14; fibroblast growth factor homologous factor 4; SCA27.

Gene ID

2259

Accession Number

NP_004106

Reactivity

Homo sapiens|Human

Target

Probably involved in nervous system development and function.

Type

Protein

Source

E.coli

Sequence

MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

FGF14

Protein Name

Fibroblast growth factor 14

Gene Name URL

FGF14

Nucleotide Accession Number

NM_004115

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal IGFBP-5 Antibody
NBP2-68755 100 µL

Rabbit Polyclonal IGFBP-5 Antibody

Sign In for Pricing
View Details
GENLISA™ Bovine Hemoglobin (HB) ELISA
KLB2317 1x 96 Well

GENLISA™ Bovine Hemoglobin (HB) ELISA

Sign In for Pricing
View Details
Casein (CSN1S1) (NM_001890) Human Tagged Lenti ORF Clone
RC223721L4 10 µg

Casein (CSN1S1) (NM_001890) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
TOP3B-set siRNA/shRNA/RNAi Lentivector (Human)
47309091 4x 500 ng

TOP3B-set siRNA/shRNA/RNAi Lentivector (Human)

Sign In for Pricing
View Details
MALT1 (Mucosa Associated Lymphoid Tissue Lymphoma Translocation Gene 1, DKFZp434L132, MLT, MLT1) (PE)
MBS6187615-01 0.1 mL

MALT1 (Mucosa Associated Lymphoid Tissue Lymphoma Translocation Gene 1, DKFZp434L132, MLT, MLT1) (PE)

Sign In for Pricing
View Details
MALT1 (Mucosa Associated Lymphoid Tissue Lymphoma Translocation Gene 1, DKFZp434L132, MLT, MLT1) (PE)
MBS6187615-02 5x 0.1 mL

MALT1 (Mucosa Associated Lymphoid Tissue Lymphoma Translocation Gene 1, DKFZp434L132, MLT, MLT1) (PE)

Sign In for Pricing
View Details