Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THRSP Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Thyroid hormone responsive

Gene Aliases

Lipogenic protein 1; Lpgp; LPGP1; S14; spot 14 protein; SPOT14; SPOT14 homolog; THRP; thyroid hormone responsive (SPOT14 homolog, rat) ; thyroid hormone-inducible hepatic protein.

Gene ID

7069

Accession Number

NP_003242

Reactivity

Homo sapiens|Human

Target

Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA (By similarity) . May function as transcriptional coactivator. May modulate the transcription factor activity of THRB.

Type

Protein

Source

E.coli

Sequence

MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

THRSP

Protein Name

Thyroid hormone-inducible hepatic protein

Gene Name URL

THRSP

Nucleotide Accession Number

NM_003251

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDG2, NT (LPAR1, EDG2, LPA1, Lysophosphatidic acid receptor 1, Lysophosphatidic acid receptor Edg-2) (Azide free) (HRP)
MBS6294350-01 0.2 mL

EDG2, NT (LPAR1, EDG2, LPA1, Lysophosphatidic acid receptor 1, Lysophosphatidic acid receptor Edg-2) (Azide free) (HRP)

Sign In for Pricing
View Details
EDG2, NT (LPAR1, EDG2, LPA1, Lysophosphatidic acid receptor 1, Lysophosphatidic acid receptor Edg-2) (Azide free) (HRP)
MBS6294350-02 5x 0.2 mL

EDG2, NT (LPAR1, EDG2, LPA1, Lysophosphatidic acid receptor 1, Lysophosphatidic acid receptor Edg-2) (Azide free) (HRP)

Sign In for Pricing
View Details
ABL2 (NM_005158) Human Tagged ORF Clone Lentiviral Particle
RC218110L3V 200 µL

ABL2 (NM_005158) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
CCL17 Rabbit Polyclonal Antibody (Biotin)
orb113998 100 µL

CCL17 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Pbx 4 CRISPR/Cas9 KO Plasmid (h)
sc-413388 20 µg

Pbx 4 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
Anti-Cav1.3 Ca2+ channel Antibody (L48A/29)
HC257013-01 50 µg

Anti-Cav1.3 Ca2+ channel Antibody (L48A/29)

Sign In for Pricing
View Details