Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

THRSP Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Thyroid hormone responsive

Gene Aliases

Lipogenic protein 1; Lpgp; LPGP1; S14; spot 14 protein; SPOT14; SPOT14 homolog; THRP; thyroid hormone responsive (SPOT14 homolog, rat) ; thyroid hormone-inducible hepatic protein.

Gene ID

7069

Accession Number

NP_003242

Reactivity

Homo sapiens|Human

Target

Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA (By similarity) . May function as transcriptional coactivator. May modulate the transcription factor activity of THRB.

Type

Protein

Source

E.coli

Sequence

MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQAEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKVAGSEENGTAETEEVEDESASGELDLEAQFHLHFSSLHHILMHLTEKAQEVTRKYQEMTGQVW

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

THRSP

Protein Name

Thyroid hormone-inducible hepatic protein

Gene Name URL

THRSP

Nucleotide Accession Number

NM_003251

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EZBlock™ Protease Inhibitor Cocktail II
K277-set Set (5x 1 Vial)

EZBlock™ Protease Inhibitor Cocktail II

Sign In for Pricing
View Details
CRIP2 Rabbit Polyclonal Antibody (PE)
orb487440 100 µL

CRIP2 Rabbit Polyclonal Antibody (PE)

Sign In for Pricing
View Details
Chrnb2 Mouse qPCR Template Standard (NM_009602)
MK202868 1 Kit

Chrnb2 Mouse qPCR Template Standard (NM_009602)

Sign In for Pricing
View Details
OPLAH siRNA Oligos set (Human)
34844171 3x 5 nmol

OPLAH siRNA Oligos set (Human)

Sign In for Pricing
View Details
NUDT6 Rabbit Polyclonal Antibody
E10G02142 100 µL

NUDT6 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Vericiguat Impurity 39
RM-V309039-01 10 mg

Vericiguat Impurity 39

Sign In for Pricing
View Details