Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SMPX Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Small muscle protein X-linked

Gene Aliases

Chisel; Csl; deafness, X-linked 6, sensorineural; DFN6; DFNX4; small muscular protein; stretch-responsive skeletal muscle protein.

Gene ID

23676

Accession Number

NP_055147

Reactivity

Homo sapiens|Human

Target

Plays a role in the regulatory network through which muscle cells coordinate their structural and functional states during growth, adaptation, and repair.

Type

Protein

Source

E.coli

Sequence

MNMSKQPVSNVRAIQANINIPMGAFRPGAGQPPRRKECTPEVEEGVPPTSDEEKKPIPGAKKLPGPAVNLSEIQNIKSELKYVPKAEQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SMPX

Protein Name

Small muscular protein

Gene Name URL

SMPX

Nucleotide Accession Number

NM_014332

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Reg3g ORF Vector (Rat) (pORF)
38799016 1.0 µg DNA

Reg3g ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
TMEM121 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)
46877064 1.0 µg DNA

TMEM121 Lentiviral Vector (Mouse) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Lentiviral mouse Fbxo42 shRNA (UAS) - Lentiviral mouseFbxo42 shRNA (UAS, GFP) (25)
GTR15280256 1 Vial

Lentiviral mouse Fbxo42 shRNA (UAS) - Lentiviral mouseFbxo42 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
Lamin B1 Monoclonal Antibody (15T1)
A01090A680 100 µL

Lamin B1 Monoclonal Antibody (15T1)

Sign In for Pricing
View Details
Recombinant Yersinia Enterocolitica pncB Protein (aa 1-401) (strain 8081)
VAng-Cr2153-500gEcoli 500 µg (E. coli)

Recombinant Yersinia Enterocolitica pncB Protein (aa 1-401) (strain 8081)

Sign In for Pricing
View Details
Porcine Thioredoxin Domain-Containing Protein 12 (TXNDC12) ELISA Kit
MBS9928316-01 48 Well

Porcine Thioredoxin Domain-Containing Protein 12 (TXNDC12) ELISA Kit

Sign In for Pricing
View Details