Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A20 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Solute carrier family 25 member 20

Gene Aliases

CAC; CACT; Carnitine/acylcarnitine translocase; mitochondrial carnitine/acylcarnitine carrier protein; solute carrier family 25 (carnitine/acylcarnitine translocase), member 20; Solute carrier family 25 member 20.

Gene ID

788

Accession Number

NP_000378

Reactivity

Homo sapiens|Human

Target

Mediates the transport of acylcarnitines of different length across the mitochondrial inner membrane from the cytosol to the mitochondrial matrix for their oxidation by the mitochondrial fatty acid-oxidation pathway.

Type

Protein

Source

E.coli

Sequence

MADQPKPISPLKNLLAGGFGGVCLVFVGHPLDTVKVRLQTQPPSLPGQPPMYSGTFDCFRKTLFREGITGLYRGMAAPIIGVTPMFAVCFFGFGLGKKLQQKHPEDVLSYPQLFAAGMLSGVFTTGIMTPGERIKCLLQIQASSGESKYTGTLDCAKKLYQEFGIRGIYKGTVLTLMRDVPASGMYFMTYEWLKNIFTPEGKRVSELSAPRILVAGGIAGIFNWAVAIPPDVLKSRFQTAPPGKYPNGFRDVLRELIRDEGVTSLYKGFNAVMIRAFPANAACFLGFEVAMKFLNWATPNL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

59.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SLC25A20

Protein Name

Mitochondrial carnitine/acylcarnitine carrier protein

Gene Name URL

SLC25A20

Nucleotide Accession Number

NM_000387

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-ECS Antibody
18830 1mg

Anti-ECS Antibody

Sign In for Pricing
View Details
Mouse Elastase 4 Ela4 ELISA Kit
BG-MUS10847 1 Each

Mouse Elastase 4 Ela4 ELISA Kit

Sign In for Pricing
View Details
Dog Cytotoxin Associated Protein gene A ELISA Kit
GTR10477987-01 48 Well

Dog Cytotoxin Associated Protein gene A ELISA Kit

Sign In for Pricing
View Details
Dog Cytotoxin Associated Protein gene A ELISA Kit
GTR10477987-02 96 Well

Dog Cytotoxin Associated Protein gene A ELISA Kit

Sign In for Pricing
View Details
Dog Cytotoxin Associated Protein gene A ELISA Kit
GTR10477987-03 192 Well

Dog Cytotoxin Associated Protein gene A ELISA Kit

Sign In for Pricing
View Details
FTH1 Mouse Monoclonal Antibody
orb632884-01 50 µg

FTH1 Mouse Monoclonal Antibody

Sign In for Pricing
View Details