Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NUTF2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Nuclear transport factor 2

Gene Aliases

NTF2; NTF-2; nuclear transport factor 2; placental protein 15; PP15.

Gene ID

10204

Accession Number

NP_001308967

Reactivity

Homo sapiens|Human

Target

Mediates the import of GDP-bound RAN from the cytoplasm into the nucleus which is essential for the function of RAN in cargo receptor-mediated nucleocytoplasmic transport. Thereby, plays indirectly a more general role in cargo receptor-mediated nucleocytoplasmic transport. Interacts with GDP-bound RAN in the cytosol, recruits it to the nuclear pore complex via its interaction with nucleoporins and promotes its nuclear import.

Type

Protein

Source

E.coli

Sequence

MGDKPIWEQIGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

41.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NUTF2

Protein Name

Nuclear transport factor 2

Gene Name URL

NUTF2

Nucleotide Accession Number

NM_001322038

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral human TMEM11 sgRNA gene knockout kit - Lentiviral human TMEM11 sgRNA gene knockout kit (100)
GTR15371491 1 Vial

Lentiviral human TMEM11 sgRNA gene knockout kit - Lentiviral human TMEM11 sgRNA gene knockout kit (100)

Sign In for Pricing
View Details
Anti-Parvin alpha/PARVA Antibody, Rabbit Polyclonal
MBS8107175-01 0.1 mL

Anti-Parvin alpha/PARVA Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-Parvin alpha/PARVA Antibody, Rabbit Polyclonal
MBS8107175-02 5x 0.1 mL

Anti-Parvin alpha/PARVA Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Human TP53INP1 Knockout HEK293T cell line
GTR15407890 1 Vial

Human TP53INP1 Knockout HEK293T cell line

Sign In for Pricing
View Details
Noa1 (NM_019836) Mouse Untagged Clone
MC220509 10 µg

Noa1 (NM_019836) Mouse Untagged Clone

Sign In for Pricing
View Details
IFluor® 594 Anti-human CD102 Antibody *CBR-IC2/2*
110200C0-AAT 100 Tests

IFluor® 594 Anti-human CD102 Antibody *CBR-IC2/2*

Sign In for Pricing
View Details