Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

NAPG Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

NSF attachment protein gamma

Gene Aliases

GAMMASNAP; gamma-soluble NSF attachment protein; N-ethylmaleimide-sensitive factor attachment protein gamma; N-ethylmaleimide-sensitive factor attachment protein, gamma; SNAP-gamma; soluble NSF attachment protein.

Gene ID

8774

Accession Number

NP_003817

Reactivity

Homo sapiens|Human

Target

Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.

Type

Protein

Source

E.coli

Sequence

MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

61.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

NAPG

Protein Name

Gamma-soluble NSF attachment protein

Gene Name URL

NAPG

Nucleotide Accession Number

NM_003826

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal ALG12 Antibody
NBP2-14282-25ul 25 µL

Rabbit Polyclonal ALG12 Antibody

Sign In for Pricing
View Details
HPIV-1 Fusion glycoprotein F0 Antibody
orb3152368-01 50 µg

HPIV-1 Fusion glycoprotein F0 Antibody

Sign In for Pricing
View Details
HPIV-1 Fusion glycoprotein F0 Antibody
orb3152368-02 100 µg

HPIV-1 Fusion glycoprotein F0 Antibody

Sign In for Pricing
View Details
HPIV-1 Fusion glycoprotein F0 Antibody
orb3152368-03 1 mg

HPIV-1 Fusion glycoprotein F0 Antibody

Sign In for Pricing
View Details
LGI1 Antibody
4489-01mg 0.1 mg

LGI1 Antibody

Sign In for Pricing
View Details
TAF6L (TAF6-like RNA Polymerase II p300/CBP-associated Factor-associated Factor 65kD Subunit 6L, PCAF-associated Factor 65-alpha, PAF65-alpha, PAF65A) (AP) discontinued
134194-AP 100 µL

TAF6L (TAF6-like RNA Polymerase II p300/CBP-associated Factor-associated Factor 65kD Subunit 6L, PCAF-associated Factor 65-alpha, PAF65-alpha, PAF65A) (AP) discontinued

Sign In for Pricing
View Details