Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

MGLL Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Monoglyceride lipase

Gene Aliases

HUK5; HU-K5; lysophospholipase homolog; Lysophospholipase-like; MAGL; MGL; monoacylglycerol lipase; monoglyceride lipase.

Gene ID

11343

Accession Number

NP_001003794

Reactivity

Homo sapiens|Human

Target

Converts monoacylglycerides to free fatty acids and glycerol. Hydrolyzes the endocannabinoid 2-arachidonoylglycerol, and thereby contributes to the regulation of endocannabinoid signaling, nociperception and perception of pain (By similarity) . Regulates the levels of fatty acids that serve as signaling molecules and promote cancer cell migration, invasion and tumor growth (PubMed:20079333) .

Type

Protein

Source

E.coli

Sequence

MPEESSPRRTPQSIPYQDLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHSGRYEELARMLMGLDLLVFAHDHVGHGQSEGERMVVSDFHVFVRDVLQHVDSMQKDYPGLPVFLLGHSMGGAIAILTAAERPGHFAGMVLISPLVLANPESATTFKVLAAKVLNLVLPNLSLGPIDSSVLSRNKTEVDIYNSDPLICRAGLKVCFGIQLLNAVSRVERALPKLTVPFLLLQGSADRLCDSKGAYLLMELAKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRTATAGTASPP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

60.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

MGLL

Protein Name

Monoglyceride lipase

Gene Name URL

MGLL

Nucleotide Accession Number

NM_001003794

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Calpain 1 Antibody
NBP2-15671 0.1 mL

Rabbit Polyclonal Calpain 1 Antibody

Sign In for Pricing
View Details
TPD52 Rabbit Polyclonal Antibody (Biotin)
orb2114584 100 µL

TPD52 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
Mouse Monoclonal Transglutaminase 2/TGM2 Antibody (SPM592) [Allophycocyanin/Cy7]
NBP2-47927APCCY7 0.1 mL

Mouse Monoclonal Transglutaminase 2/TGM2 Antibody (SPM592) [Allophycocyanin/Cy7]

Sign In for Pricing
View Details
PSMD3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
38002063 1.0 µg DNA

PSMD3 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Pigeon Solute Carrier Family 22 Member 3 (SLC22A3) ELISA Kit
MBS9355795 Inquire

Pigeon Solute Carrier Family 22 Member 3 (SLC22A3) ELISA Kit

Sign In for Pricing
View Details
Recombinant Human Platelet-Derived Growth Factor Receptor β/PDGFR-β (C-6His)
C380-500ug 500 µg

Recombinant Human Platelet-Derived Growth Factor Receptor β/PDGFR-β (C-6His)

Sign In for Pricing
View Details