Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HAND2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Heart and neural crest derivatives expressed 2

Gene Aliases

Basic helix-loop-helix transcription factor HAND2; bHLHa26; class A basic helix-loop-helix protein 26; deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2; dHand; DHAND2; heart- and neural crest derivatives-expressed protein 2; Hed; Thing2.

Gene ID

9464

Accession Number

NP_068808

Reactivity

Homo sapiens|Human

Target

Essential for cardiac morphogenesis, particularly for the formation of the right ventricle and of the aortic arch arteries. Required for vascular development and regulation of angiogenesis, possibly through a VEGF signaling pathway. Plays also an important role in limb development, particularly in the establishment of anterior-posterior polarization, acting as an upstream regulator of sonic hedgehog (SHH) induction in the limb bud. Is involved in the development of branchial arches, which give rise to unique structures in the head and neck. Binds DNA on E-box consensus sequence 5'-CANNTG-3' (By similarity) .

Type

Protein

Source

E.coli

Sequence

MSLVGGFPHHPVVHHEGYPFAAAAAASRCSHEENPYFHGWLIGHPEMSPPDYSMALSYSPEYASGTANRKERRRTQSINSAFAELRECIPNVPADTKLSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELKQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HAND2

Protein Name

Heart- and neural crest derivatives-expressed protein 2

Gene Name URL

HAND2

Nucleotide Accession Number

NM_021973

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-AKR1C3 antibody
STJ70651 100 µg

Anti-AKR1C3 antibody

Sign In for Pricing
View Details
Human LA/SS-B Protein
orb611147-01 50 µg

Human LA/SS-B Protein

Sign In for Pricing
View Details
Human LA/SS-B Protein
orb611147-02 100 µg

Human LA/SS-B Protein

Sign In for Pricing
View Details
Human LA/SS-B Protein
orb611147-03 1 mg

Human LA/SS-B Protein

Sign In for Pricing
View Details
Blocking solution for rabbit gold conjugates
905.003 30 mL

Blocking solution for rabbit gold conjugates

Sign In for Pricing
View Details
Ovalbumin ELISA Kit
ECP7914 1 Each

Ovalbumin ELISA Kit

Sign In for Pricing
View Details