Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHDH Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Dihydrodiol dehydrogenase

Gene Aliases

2DD;3-deoxyglucosone reductase; dihydrodiol dehydrogenase (dimeric) ; Dimeric dihydrodiol dehydrogenase; D-xylose 1-dehydrogenase; D-xylose-NADP dehydrogenase; HUM2DD; trans-1,2-dihydrobenzene-1,2-diol dehydrogenase.

Gene ID

27294

Accession Number

NP_055290

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MALRWGIVSVGLISSDFTAVLQTLPRSEHQVVAVAARDLSRAKEFAQKHDIPKAYGSYEELAKDPSVEVAYIGTQHPQHKAAVMLCLAAGKAVLCEKPTGVNAAEVREMVAEARSRALFLMEAIWTRFFPASEALRSVLAQGTLGDLRVARAEFGKNLIHVPRAVDRAQAGGALLDIGIYCVQFTSMVFGGQKPEKISVVGRRHETGVDDTVTVLLQYPGEVHGSFTCSITVQLSNTASVSGTKGMVQLLNPCWCPTELVVKGEHKEFPLPPVPKDCNFDNGAGMSYEAKHVWECLRKGMKESPVIPLSESELLADILEEVRKAIGVTFPQDKR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

63.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

DHDH

Protein Name

Trans-1,2-dihydrobenzene-1,2-diol dehydrogenase

Gene Name URL

DHDH

Nucleotide Accession Number

NM_014475

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P2RY4 AAV Vector (Mouse) (CMV)
35872104 1 µg

P2RY4 AAV Vector (Mouse) (CMV)

Sign In for Pricing
View Details
ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (APC)
MBS6166720-01 0.1 mL

ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (APC)

Sign In for Pricing
View Details
ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (APC)
MBS6166720-02 5x 0.1 mL

ROR2 (Receptor Tyrosine Kinase-like orphan Receptor 2, BDB, BDB1, MGC163394, NTRKR2) (APC)

Sign In for Pricing
View Details
IGHD5-5 sgRNA CRISPR Lentivector set (Human)
K1029801 3x 1.0 µg

IGHD5-5 sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
SHBG (Sex Hormone Binding Globulin) Sheep ELISA Kit
H0602 96 Tests

SHBG (Sex Hormone Binding Globulin) Sheep ELISA Kit

Sign In for Pricing
View Details
Wdr70 3'UTR GFP Stable Cell Line
TU172256 1.0 mL

Wdr70 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details