Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TUSC2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Tumor suppressor 2, mitochondrial calcium regulator

Gene Aliases

C3orf11; FUS1; fus-1 protein; fusion 1 protein; PAP; PDAP2; PDGFA-associated protein 2; tumor suppressor candidate 2.

Gene ID

11334

Accession Number

NP_009206

Reactivity

Homo sapiens|Human

Target

May function as a tumor suppressor, inhibiting colony formation, causing G1 arrest and ultimately inducing apoptosis in homozygous 3p21.3 120-kb region-deficient cells.

Type

Protein

Source

E.coli

Sequence

GASGSKARGLWPFASAAGGGGSEAAGAEQALVRPRGRAVPPFVFTRRGSMFYDEDGDLAHEFYEETIVTKNGQKRAKLRRVHKNLIPQGIVKLDHPRIHVDFPVILYEV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TUSC2

Protein Name

Tumor suppressor candidate 2

Gene Name URL

TUSC2

Nucleotide Accession Number

NM_007275

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PAFAH1B3 (Platelet-activating Factor Acetylhydrolase IB subunit gamma, PAF Acetylhydrolase 29kD Subunit, PAF-AH 29kD Subunit, PAF-AH Subunit gamma, PAFAH Subunit gamma, PAFAHG) (Biotin)
MBS6143345-01 0.1 mL

PAFAH1B3 (Platelet-activating Factor Acetylhydrolase IB subunit gamma, PAF Acetylhydrolase 29kD Subunit, PAF-AH 29kD Subunit, PAF-AH Subunit gamma, PAFAH Subunit gamma, PAFAHG) (Biotin)

Sign In for Pricing
View Details
PAFAH1B3 (Platelet-activating Factor Acetylhydrolase IB subunit gamma, PAF Acetylhydrolase 29kD Subunit, PAF-AH 29kD Subunit, PAF-AH Subunit gamma, PAFAH Subunit gamma, PAFAHG) (Biotin)
MBS6143345-02 5x 0.1 mL

PAFAH1B3 (Platelet-activating Factor Acetylhydrolase IB subunit gamma, PAF Acetylhydrolase 29kD Subunit, PAF-AH 29kD Subunit, PAF-AH Subunit gamma, PAFAH Subunit gamma, PAFAHG) (Biotin)

Sign In for Pricing
View Details
CPNE9 siRNA (Human)
CRJ5714-01 15 nmol

CPNE9 siRNA (Human)

Sign In for Pricing
View Details
CPNE9 siRNA (Human)
CRJ5714-02 30 nmol

CPNE9 siRNA (Human)

Sign In for Pricing
View Details
6- (Dimethylamino) naphtho[2,3-c]furan-1,3-dione
OR1071158-01 50 mg

6- (Dimethylamino) naphtho[2,3-c]furan-1,3-dione

Sign In for Pricing
View Details
6- (Dimethylamino) naphtho[2,3-c]furan-1,3-dione
OR1071158-02 100 mg

6- (Dimethylamino) naphtho[2,3-c]furan-1,3-dione

Sign In for Pricing
View Details