Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

YEATS4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

YEATS domain containing 4

Gene Aliases

4930573H17Rik; B230215M10Rik; GAS41; glioma-amplified sequence 41; nuBI1; NUBI-1; NuMA binding protein 1; NuMA-binding protein 1; YAF9; YEATS domain-containing protein 4.

Gene ID

8089

Accession Number

NP_001287879

Reactivity

Homo sapiens|Human

Target

Component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and promote interaction of the modified histones with other proteins which positively regulate transcription. This complex may be required for the activation of transcriptional programs associated with oncogene and proto-oncogene mediated growth induction, tumor suppressor mediated growth arrest and replicative senescence, apoptosis, and DNA repair. NuA4 may also play a direct role in DNA repair when recruited to sites of DNA damage.

Type

Protein

Source

E.coli

Sequence

MFKRMAEFGPDSGGRVKGVTIVKPIVYGNVARYFGKKREEDGHTHQWTVYVKPYRNEDMSAYVKKIQFKLHESYGNPLRVVTKPPYEITETGWGEFEIIIKIFFIDPNERPVTLYHLLKLFQSDTNAMLGKKTVVSEFYDEMIFQDPTAMMQQLLTTSRQLTLGAYKHETEFAELEVKTREKLEAAKKKTSFEIAELKERLKASRETINCLKNEIRKLEEDDQAKDI

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

53.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

YEATS4

Protein Name

YEATS domain-containing protein 4

Gene Name URL

YEATS4

Nucleotide Accession Number

NM_001300950

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Adrenomedullin (ADM) ELISA Kit
RDR-ADM-p-96Tests 96 Tests

Porcine Adrenomedullin (ADM) ELISA Kit

Sign In for Pricing
View Details
AVN 322 free base
BUP01249-01 1 mg

AVN 322 free base

Sign In for Pricing
View Details
AVN 322 free base
BUP01249-02 5 mg

AVN 322 free base

Sign In for Pricing
View Details
AVN 322 free base
BUP01249-03 10 mg

AVN 322 free base

Sign In for Pricing
View Details
AVN 322 free base
BUP01249-04 25 mg

AVN 322 free base

Sign In for Pricing
View Details
AVN 322 free base
BUP01249-05 50 mg

AVN 322 free base

Sign In for Pricing
View Details