Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ITGB3BP Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Integrin subunit beta 3 binding protein

Gene Aliases

Beta 3 endonexin; beta3-endonexin; Beta-3-endonexin; CENPR; CENP-R; centromere protein R; HSU37139; integrin beta 3 binding protein (beta3-endonexin) ; integrin beta-3-binding protein; NRIF3; nuclear receptor-interacting factor 3; TAP20.

Gene ID

23421

Accession Number

NP_001193668

Reactivity

Homo sapiens|Human

Target

Transcription coregulator that can have both coactivator and corepressor functions. Isoform 1, but not other isoforms, is involved in the coactivation of nuclear receptors for retinoid X (RXRs) and thyroid hormone (TRs) in a ligand-dependent fashion. In contrast, it does not coactivate nuclear receptors for retinoic acid, vitamin D, progesterone receptor, nor glucocorticoid. Acts as a coactivator for estrogen receptor alpha. Acts as a transcriptional corepressor via its interaction with the NFKB1 NF-kappa-B subunit, possibly by interfering with the transactivation domain of NFKB1. Induces apoptosis in breast cancer cells, but not in other cancer cells, via a caspase-2 mediated pathway that involves mitochondrial membrane permeabilization but does not require other caspases. May also act as an inhibitor of cyclin A-associated kinase. Also acts a component of the CENPA-CAD (nucleosome distal) complex, a complex recruited to centromeres which is involved in assembly of kinetochore proteins, mitotic progression and chromosome segregation. May be involved in incorporation of newly synthesized CENPA into centromeres via its interaction with the CENPA-NAC complex.

Type

Protein

Source

E.coli

Sequence

MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQALEGSRELENLIGISCASHFLKREMQKTKELMTKVNKQKLFEKSTGLPHKASRHLDSYEFLKAILN

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ITGB3BP

Protein Name

Centromere protein R

Gene Name URL

ITGB3BP

Nucleotide Accession Number

NM_001206739

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SMI-4a
sc-364140 5 mg

SMI-4a

Sign In for Pricing
View Details
Human NUDT2 knockdown cell line
ABC-KD10421 1 Vial

Human NUDT2 knockdown cell line

Sign In for Pricing
View Details
ARHGEF9 (Center) Rabbit pAb
MBS8553844-01 0.1 mL

ARHGEF9 (Center) Rabbit pAb

Sign In for Pricing
View Details
ARHGEF9 (Center) Rabbit pAb
MBS8553844-02 0.1 mL (AF405L)

ARHGEF9 (Center) Rabbit pAb

Sign In for Pricing
View Details
ARHGEF9 (Center) Rabbit pAb
MBS8553844-03 0.1 mL (AF405S)

ARHGEF9 (Center) Rabbit pAb

Sign In for Pricing
View Details
ARHGEF9 (Center) Rabbit pAb
MBS8553844-04 0.1 mL (AF610)

ARHGEF9 (Center) Rabbit pAb

Sign In for Pricing
View Details