Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C8ORF4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Transcriptional and immune response regulator

Gene Aliases

C8orf4; human thyroid cancer 1; protein C8orf4; TC1; TC-1; thyroid cancer protein 1; transcriptional and immune response regulator.

Gene ID

56892

Accession Number

NP_064515

Reactivity

Homo sapiens|Human

Target

Seems to be involved in the regulation of cell growth an differentiation, may play different and opposite roles depending on the tissue or cell type. May enhance the WNT-CTNNB1 pathway by relieving antagonistic activity of CBY1 (PubMed:16424001, PubMed:16730711) . Enhances the proliferation of follicular dendritic cells (PubMed:16730711) . Plays a role in the mitogen-activated MAPK2/3 signaling pathway, positively regulates G1-to-S-phase transition of the cell cycle (PubMed:18959821) . In endothelial cells, enhances key inflammatory mediators and inflammatory response through the modulation of NF-kappaB transcriptional regulatory activity (PubMed:19684084) . Involved in the regulation of heat shock response, seems to play a positive feedback with HSF1 to modulate heat-shock downstream gene expression (PubMed:17603013) . Plays a role in the regulation of hematopoiesis even if the mechanisms are unknown (By similarity) . In cancers such as thyroid or lung cancer, it has been described as promoter of cell proliferation, G1-to-S-phase transition and inhibitor of apoptosis (PubMed:15087392, PubMed:24941347) . However, it negatively regulates self-renewal of liver cancer cells via suppresion of NOTCH2 signaling (PubMed:25985737) .

Type

Protein

Source

E.coli

Sequence

MKAKRSHQAVIMSTSLRVSPSIHGYHFDTASRKKAVGNIFENTDQESLERLFRNSGDKKAEERAKIIFAIDQDVEEKTRALMALKKRTKDKLFQFLKLRKYSIKVH

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TCIM

Protein Name

Transcriptional and immune response regulator

Gene Name URL

TCIM

Nucleotide Accession Number

NM_020130

Curated Selection

Explore Other Products

Discover premium biology products from our extensive collection of 20M+ items

RAC1 (1-192, His-tag) Human Protein
AR09286PU-L 500 µg

RAC1 (1-192, His-tag) Human Protein

Ask
View Details
Mouse Monoclonal Monoglyceride Lipase Antibody (OTI2B11) [Alexa Fluor 594]
NBP2-72759AF594 0.1 mL

Mouse Monoclonal Monoglyceride Lipase Antibody (OTI2B11) [Alexa Fluor 594]

Ask
View Details
Recombinant Shigella flexneri Endo-type membrane-bound lytic murein transglycosylase A-like protein (emtA2)
MBS1309973-01 0.02 mg (E-Coli)

Recombinant Shigella flexneri Endo-type membrane-bound lytic murein transglycosylase A-like protein (emtA2)

Ask
View Details
Recombinant Shigella flexneri Endo-type membrane-bound lytic murein transglycosylase A-like protein (emtA2)
MBS1309973-02 0.1 mg (E-Coli)

Recombinant Shigella flexneri Endo-type membrane-bound lytic murein transglycosylase A-like protein (emtA2)

Ask
View Details
Recombinant Shigella flexneri Endo-type membrane-bound lytic murein transglycosylase A-like protein (emtA2)
MBS1309973-03 0.02 mg (Yeast)

Recombinant Shigella flexneri Endo-type membrane-bound lytic murein transglycosylase A-like protein (emtA2)

Ask
View Details
Recombinant Shigella flexneri Endo-type membrane-bound lytic murein transglycosylase A-like protein (emtA2)
MBS1309973-04 0.1 mg (Yeast)

Recombinant Shigella flexneri Endo-type membrane-bound lytic murein transglycosylase A-like protein (emtA2)

Ask
View Details