Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SPIN1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Spindlin 1

Gene Aliases

Ovarian cancer-related protein; SPIN; spindlin1; spindlin-1; TDRD24.

Gene ID

10927

Accession Number

NP_006708

Reactivity

Homo sapiens|Human

Target

Chromatin reader that specifically recognizes and binds histone H3 both trimethylated at 'Lys-4' and asymmetrically dimethylated at 'Arg-8' (H3K4me3 and H3R8me2a) and acts as an activator of Wnt signaling pathway downstream of PRMT2. In case of cancer, promotes cell cancer proliferation via activation of the Wnt signaling pathway (PubMed:24589551) . Overexpression induces metaphase arrest and chromosomal instability. Localizes to active rDNA loci and promotes the expression of rRNA genes (PubMed:21960006) . May play a role in cell-cycle regulation during the transition from gamete to embryo. Involved in oocyte meiotic resumption, a process that takes place before ovulation to resume meiosis of oocytes blocked in prophase I: may act by regulating maternal transcripts to control meiotic resumption.

Type

Protein

Source

E.coli

Sequence

MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNIVGCRIQHGWKEGNGPVTQWKGTVLDQVPVNPSLYLIKYDGFDCVYGLELNKDERVSALEVLPDRVATSRISDAHLADTMIGKAVEHMFETEDGSKDEWRGMVLARAPVMNTWFYITYEKDPVLYMYQLLDDYKEGDLRIMPDSNDSPPAEREPGEVVDSLVGKQVEYAKEDGSKRTGMVIHQVEAKPSVYFIKFDDDFHIYVYDLVKTS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

56.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SPIN1

Protein Name

Spindlin-1

Gene Name URL

SPIN1

Nucleotide Accession Number

NM_006717

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SLC3A1 (Solute Carrier Family 3 (cystine, dibasic and Neutral amino Acid Transporters, Activator of cystine, dibasic and Neutral amino Acid Transport), Member 1, ATR1, CSNU1, D2H, FLJ34681, NBAT, RBAT) (MaxLight 650)
251754-ML650 100 µL

SLC3A1 (Solute Carrier Family 3 (cystine, dibasic and Neutral amino Acid Transporters, Activator of cystine, dibasic and Neutral amino Acid Transport), Member 1, ATR1, CSNU1, D2H, FLJ34681, NBAT, RBAT) (MaxLight 650)

Sign In for Pricing
View Details
Zebrafish TTN Rabbit Polyclonal Antibody
orb3002735 100 µg

Zebrafish TTN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Protein Kinase Inhibitor Beta (PKIb)
TRV-0042601-01 10 µg

Recombinant Protein Kinase Inhibitor Beta (PKIb)

Sign In for Pricing
View Details
Recombinant Protein Kinase Inhibitor Beta (PKIb)
TRV-0042601-02 50 µg

Recombinant Protein Kinase Inhibitor Beta (PKIb)

Sign In for Pricing
View Details
Recombinant Protein Kinase Inhibitor Beta (PKIb)
TRV-0042601-03 100 µg

Recombinant Protein Kinase Inhibitor Beta (PKIb)

Sign In for Pricing
View Details
Recombinant Protein Kinase Inhibitor Beta (PKIb)
TRV-0042601-04 200 µg

Recombinant Protein Kinase Inhibitor Beta (PKIb)

Sign In for Pricing
View Details