What is the catalog number for GSTZ1 Recombinant Protein (Human)?

The catalog number for GSTZ1 Recombinant Protein (Human) is OPCA04866-1MG.

What sizes are available for GSTZ1 Recombinant Protein (Human)?

GSTZ1 Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is GSTZ1 Recombinant Protein (Human) in stock?

GSTZ1 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

GSTZ1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutathione S-transferase zeta 1

Gene Aliases

Glutathione S-alkyltransferase; glutathione S-aralkyltransferase; glutathione S-aryltransferase; Glutathione S-transferase zeta 1; glutathione transferase zeta 1; GSTZ1-1; MAAI; MAAID; MAI; maleylacetoacetate isomerase; maleylacetone isomerase; S- (hydroxyalkyl) glutathione lyase.

Gene ID

2954

Accession Number

NP_001299589

Reactivity

Homo sapiens|Human

Target

Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid.

Type

Protein

Source

E.coli

Sequence

MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.