Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTZ1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutathione S-transferase zeta 1

Gene Aliases

Glutathione S-alkyltransferase; glutathione S-aralkyltransferase; glutathione S-aryltransferase; Glutathione S-transferase zeta 1; glutathione transferase zeta 1; GSTZ1-1; MAAI; MAAID; MAI; maleylacetoacetate isomerase; maleylacetone isomerase; S- (hydroxyalkyl) glutathione lyase.

Gene ID

2954

Accession Number

NP_001299589

Reactivity

Homo sapiens|Human

Target

Bifunctional enzyme showing minimal glutathione-conjugating activity with ethacrynic acid and 7-chloro-4-nitrobenz-2-oxa-1,3-diazole and maleylacetoacetate isomerase activity. Has also low glutathione peroxidase activity with T-butyl and cumene hydroperoxides. Is able to catalyze the glutathione dependent oxygenation of dichloroacetic acid to glyoxylic acid.

Type

Protein

Source

E.coli

Sequence

MQAGKPILYSYFRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDGITIHQSLAIIEYLEEMRPTPRLLPQDPKKRASVRMISDLIAGGIQPLQNLSVLKQVGEEMQLTWAQNAITCGFNALEQILQSTAGIYCVGDEVTMADLCLVPQVANAERFKVDLTPYPTISSINKRLLVLEAFQVSHPCRQPDTPTELRA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

51.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GSTZ1

Protein Name

Maleylacetoacetate isomerase

Gene Name URL

GSTZ1

Nucleotide Accession Number

NM_001312660

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal CRTH-2/GPR44 Antibody (54N3F8) - Azide and BSA Free
NBP2-80682 0.1 mg

Mouse Monoclonal CRTH-2/GPR44 Antibody (54N3F8) - Azide and BSA Free

Sign In for Pricing
View Details
FGF13 Rabbit Polyclonal Antibody (APC)
orb994994 100 µL

FGF13 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
EGFR Rabbit Monoclonal Antibody [Clone ID: 2F8 (Zalutumumab; HuMax-EGFR)]
TA386419 200 µg

EGFR Rabbit Monoclonal Antibody [Clone ID: 2F8 (Zalutumumab; HuMax-EGFR)]

Sign In for Pricing
View Details
Hsa-miR-6841-5p miRNA Agomir
CMJ2347-01 5 nmol

Hsa-miR-6841-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-6841-5p miRNA Agomir
CMJ2347-02 10 nmol

Hsa-miR-6841-5p miRNA Agomir

Sign In for Pricing
View Details
Hsa-miR-6841-5p miRNA Agomir
CMJ2347-03 20 nmol

Hsa-miR-6841-5p miRNA Agomir

Sign In for Pricing
View Details