Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

PSME1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Proteasome activator subunit 1

Gene Aliases

11S regulator complex subunit alpha;29-kD MCP activator subunit; activator of multicatalytic protease subunit 1; epididymis secretory sperm binding protein Li 129m; HEL-S-129m; IFI5111; IGUP I-5111; interferon gamma up-regulated I-5111 protein; interferon-gamma IEF SSP 5111; interferon-gamma-inducible protein 5111; PA28A; PA28alpha; proteasome (prosome, macropain) activator subunit 1 (PA28 alpha) ; Proteasome activator 28 subunit alpha; proteasome activator complex subunit 1; REGalpha.

Gene ID

5720

Accession Number

NP_001268457

Reactivity

Homo sapiens|Human

Target

Implicated in immunoproteasome assembly and required for efficient antigen processing. The PA28 activator complex enhances the generation of class I binding peptides by altering the cleavage pattern of the proteasome.

Type

Protein

Source

E.coli

Sequence

MAMLRVQPEAQAKVDVFREDLCTKTENLLGSYFPKKISELDAFLKEPALNEANLSNLKAPLDIPVPDPVKEKEKEERKKQQEKEDKDEKKKGEDEDKGPPCGPVNCNEKIVVLLQRLKPEIKDVIEQLNLVTTWLQLQIPRIEDGNNFGVAVQEKVFELMTSLHTKLEGFHTQISKYFSERGDAVTKAAKQPHVGDYRQLVHELDEAEYRDIRLMVMEIRNAYAVLYDIILKNFEKLKKPRGETKGMIY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

PSME1

Protein Name

Proteasome activator complex subunit 1

Gene Name URL

PSME1

Nucleotide Accession Number

NM_001281528

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse CCL25/TECK Protein, N-His
YMA53201 100 μg

Recombinant Mouse CCL25/TECK Protein, N-His

Sign In for Pricing
View Details
Hipk1 (NM_010432) Mouse Tagged ORF Clone Lentiviral Particle
MR225509L4V 200 µL

Hipk1 (NM_010432) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
AMDHD2 Over-expression Lysate Product
GWB-4E0FE9 0.1 mg

AMDHD2 Over-expression Lysate Product

Sign In for Pricing
View Details
Recombinant Brucella Abortus fmt Protein (strain S19) (aa 1-306)
VAng-Lsx4921-500gEcoli 500 µg (E. coli)

Recombinant Brucella Abortus fmt Protein (strain S19) (aa 1-306)

Sign In for Pricing
View Details
5α-Bromo-6,19-epoxycholestanol 3-Acetate
004774 10 mg

5α-Bromo-6,19-epoxycholestanol 3-Acetate

Sign In for Pricing
View Details
AFP (alpha Fetoprotein)
226831 1 mg

AFP (alpha Fetoprotein)

Sign In for Pricing
View Details