Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

UBE2D4 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Ubiquitin conjugating enzyme E2 D4 (putative)

Gene Aliases

E2 ubiquitin-conjugating enzyme D4; HBUCE1; ubiquitin carrier protein D4; ubiquitin conjugating enzyme E2D 4 (putative) ; ubiquitin-conjugating enzyme E2 D4; ubiquitin-conjugating enzyme HBUCE1; ubiquitin-protein ligase D4.

Gene ID

51619

Accession Number

NP_057067

Reactivity

Homo sapiens|Human

Target

Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro able to promote polyubiquitination using all 7 ubiquitin Lys residues, but may prefer 'Lys-11' and 'Lys-48'-linked polyubiquitination.

Type

Protein

Source

E.coli

Sequence

MALKRIQKELTDLQRDPPAQCSAGPVGDDLFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTKIYHPNINSNGSICLDILRSQWSPALTVSKVLLSICSLLCDPNPDDPLVPEIAHTYKADREKYNRLAREWTQKYAM

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

43.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

UBE2D4

Protein Name

Ubiquitin-conjugating enzyme E2 D4

Gene Name URL

UBE2D4

Nucleotide Accession Number

NM_015983

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C5ORF62 CRISPRa sgRNA lentivector (set of three targets)(Human)
14596121 3x 1.0µg DNA

C5ORF62 CRISPRa sgRNA lentivector (set of three targets)(Human)

Sign In for Pricing
View Details
Mup7 Protein Vector (Mouse) (pPM-C-HA)
31169024 500 ng

Mup7 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
ATP5B (A-8) : m-IgG Fc BP-HRP Bundle
sc-551972 1 Kit

ATP5B (A-8) : m-IgG Fc BP-HRP Bundle

Sign In for Pricing
View Details
LIPG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8E4]
TA501048AM 100 µL

LIPG Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI8E4]

Sign In for Pricing
View Details
Fxyd6 (BC042579) Mouse Recombinant Protein
TP500248 20 µg

Fxyd6 (BC042579) Mouse Recombinant Protein

Sign In for Pricing
View Details
Human Amya (Amylase Alpha) ELISA Kit
ELK2177-01 48 Tests

Human Amya (Amylase Alpha) ELISA Kit

Sign In for Pricing
View Details