Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TOMM40 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Translocase of outer mitochondrial membrane 40

Gene Aliases

C19orf1; D19S1177E; mitochondrial import receptor subunit TOM40 homolog; mitochondrial outer membrane protein; p38.5; PEREC1; PER-EC1; protein Haymaker; TOM40; translocase of outer membrane 40 kDa subunit homolog; translocase of outer mitochondrial membrane 40 homolog.

Gene ID

10452

Accession Number

NP_001122388

Reactivity

Homo sapiens|Human

Target

Channel-forming protein essential for import of protein precursors into mitochondria.

Type

Protein

Source

E.coli

Sequence

MGNVLAASSPPAGPPPPPAPALVGLPPPPPSPPGFTLPPLGGSLGAGTSTSRSSERTPGAATASASGAAEDGACGCLPNPGTFEECHRKCKELFPIQMEGVKLTVNKGLSNHFQVNHTVALSTIGESNYHFGVTYVGTKQLSPTEAFPVLVGDMDNSGSLNAQVIHQLGPGLRSKMAIQTQQSKFVNWQVDGEYRGSDFTAAVTLGNPDVLVGSGILVAHYLQSITPCLALGGELVYHRRPGEEGTVMSLAGKYTLNNWLATVTLGQAGMHATYYHKASDQLQVGVEFEASTRMQDTSVSFGYQLDLPKANLLFKGSVDSNWIVGATLEKKLPPLPLTLALGAFLNHRKNKFQCGFGLTIG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

64.9 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TOMM40

Protein Name

Mitochondrial import receptor subunit TOM40 homolog

Gene Name URL

TOMM40

Nucleotide Accession Number

NM_001128916

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PE anti-human CD23
GT11418 100 Tests

PE anti-human CD23

Sign In for Pricing
View Details
Tesk1 Rat siRNA Oligo Duplex (Locus ID 29460)
SR508074 1 Kit

Tesk1 Rat siRNA Oligo Duplex (Locus ID 29460)

Sign In for Pricing
View Details
FAM126B Human siRNA Oligo Duplex (Locus ID 285172)
SR317211 1 Kit

FAM126B Human siRNA Oligo Duplex (Locus ID 285172)

Sign In for Pricing
View Details
Rabbit Anti-Human PLC β3 (phospho Ser537) Polyclonal Antibody
PA84026HU-01 50 µg

Rabbit Anti-Human PLC β3 (phospho Ser537) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human PLC β3 (phospho Ser537) Polyclonal Antibody
PA84026HU-02 100 µg

Rabbit Anti-Human PLC β3 (phospho Ser537) Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human PLC β3 (phospho Ser537) Polyclonal Antibody
PA84026HU-03 500 µg

Rabbit Anti-Human PLC β3 (phospho Ser537) Polyclonal Antibody

Sign In for Pricing
View Details