Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SYNGR1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Synaptogyrin 1

Gene Aliases

Synaptogyrin-1.

Gene ID

9145

Accession Number

NP_004702

Reactivity

Homo sapiens|Human

Target

May play a role in regulated exocytosis. Modulates the localization of synaptophysin/SYP into synaptic-like microvesicles and may therefore play a role in synaptic-like microvesicle formation and/or maturation (By similarity) . Involved in the regulation of short-term and long-term synaptic plasticity (By similarity) .

Type

Protein

Source

E.coli

Sequence

MEGGAYGAGKAGGAFDPYTLVRQPHTILRVVSWLFSIVVFGSIVNEGYLNSASEGEEFCIYNRNPNACSYGVAVGVLAFLTCLLYLALDVYFPQISSVKDRKKAVLSDIGVSAFWAFLWFVGFCYLANQWQVSKPKDNPLNEGTDAARAAIAFSFFSIFTWSLTAALAVRRFKDLSFQEEYSTLFPASAQP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

48 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SYNGR1

Protein Name

Synaptogyrin-1

Gene Name URL

SYNGR1

Nucleotide Accession Number

NM_004711

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

COPS2 (COP9 Signalosome Complex Subunit 2, ALIEN, COP9 Constitutive Photomorphogenic Homolog Subunit 2, CSN2, JAB1-containing Signalosome Subunit 2, Signalosome Subunit 2, SGN2, Thyroid Receptor-interacting Protein 15, TR-interacting Protein 15, TRIP 15, TRIP15, TRIP-15) (MaxLight 550)
125223-ML550 100 µL

COPS2 (COP9 Signalosome Complex Subunit 2, ALIEN, COP9 Constitutive Photomorphogenic Homolog Subunit 2, CSN2, JAB1-containing Signalosome Subunit 2, Signalosome Subunit 2, SGN2, Thyroid Receptor-interacting Protein 15, TR-interacting Protein 15, TRIP 15, TRIP15, TRIP-15) (MaxLight 550)

Sign In for Pricing
View Details
Recombinant Teredinibacter turnerae Ketol-acid reductoisomerase (ilvC)
MBS1169676-01 0.02 mg (E-Coli)

Recombinant Teredinibacter turnerae Ketol-acid reductoisomerase (ilvC)

Sign In for Pricing
View Details
Recombinant Teredinibacter turnerae Ketol-acid reductoisomerase (ilvC)
MBS1169676-02 0.02 mg (Yeast)

Recombinant Teredinibacter turnerae Ketol-acid reductoisomerase (ilvC)

Sign In for Pricing
View Details
Recombinant Teredinibacter turnerae Ketol-acid reductoisomerase (ilvC)
MBS1169676-03 0.1 mg (E-Coli)

Recombinant Teredinibacter turnerae Ketol-acid reductoisomerase (ilvC)

Sign In for Pricing
View Details
Recombinant Teredinibacter turnerae Ketol-acid reductoisomerase (ilvC)
MBS1169676-04 0.1 mg (Yeast)

Recombinant Teredinibacter turnerae Ketol-acid reductoisomerase (ilvC)

Sign In for Pricing
View Details
Recombinant Teredinibacter turnerae Ketol-acid reductoisomerase (ilvC)
MBS1169676-05 0.02 mg (Baculovirus)

Recombinant Teredinibacter turnerae Ketol-acid reductoisomerase (ilvC)

Sign In for Pricing
View Details