Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

SLC25A15 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Solute carrier family 25 member 15

Gene Aliases

D13S327; HHH; LNC-HC; mitochondrial ornithine transporter 1; ORC1; ornithine carrier 1; ornithine transporter 1; ORNT1; solute carrier family 25 (mitochondrial carrier; ornithine transporter) member 15; Solute carrier family 25 member 15.

Gene ID

10166

Accession Number

NP_055067

Reactivity

Homo sapiens|Human

Target

Ornithine-citrulline antiporter. Connects the cytosolic and the intramitochondrial reactions of the urea cycle by exchanging cytosolic ornithine with matrix citrulline (PubMed:12807890) . The stoichiometry is close to 1:1 (By similarity) .

Type

Protein

Source

E.coli

Sequence

MKSNPAIQAAIDLTAGAAGGTACVLTGQPFDTMKVKMQTFPDLYRGLTDCCLKTYSQVGFRGFYKGTSPALIANIAENSVLFMCYGFCQQVVRKVAGLDKQAKLSDLQNAAAGSFASAFAALVLCPTELVKCRLQTMYEMETSGKIAKSQNTVWSVIKSILRKDGPLGFYHGLSSTLLREVPGYFFFFGGYELSRSFFASGRSKDELGPVPLMLSGGVGGICLWLAVYPVDCIKSRIQVLSMSGKQAGFIRTFINVVKNEGITALYSGLKPTMIRAFPANGALFLAYEYSRKLMMNQLEAY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

59.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

SLC25A15

Protein Name

Mitochondrial ornithine transporter 1

Gene Name URL

SLC25A15

Nucleotide Accession Number

NM_014252

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Huntingtin-associated protein 1 (HAP1) polyclonal antibody
ABP-PAB-10627 100 ug

Huntingtin-associated protein 1 (HAP1) polyclonal antibody

Sign In for Pricing
View Details
MED31 Protein Vector (Human) (pPB-N-His)
PV025486 500 ng

MED31 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
Phospho-NFKB p65 (Thr505) Rabbit pAb, Pacific Blue conjugated
orb2858827 100 µL

Phospho-NFKB p65 (Thr505) Rabbit pAb, Pacific Blue conjugated

Sign In for Pricing
View Details
Goat Early Growth Response Protein 3 ELISA Kit
MBS037963 Inquire

Goat Early Growth Response Protein 3 ELISA Kit

Sign In for Pricing
View Details
ERVMER34-1 (NM_024534) Human Tagged Lenti ORF Clone
RC209684L3 10 µg

ERVMER34-1 (NM_024534) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
CD35 (CR1) Human Gene Knockout Kit (CRISPR)
KN216533LP 1 Kit

CD35 (CR1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details