What is the catalog number for PHB2 Recombinant Protein (Human)?

The catalog number for PHB2 Recombinant Protein (Human) is OPCA04848-100UG.

What sizes are available for PHB2 Recombinant Protein (Human)?

PHB2 Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is PHB2 Recombinant Protein (Human) in stock?

PHB2 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

PHB2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Prohibitin 2

Gene Aliases

B cell receptor associated protein 37; BAP; Bap37; BCAP37; B-cell associated protein; B-cell receptor-associated protein BAP37; D-prohibitin; hBAP; p22; PNAS-141; prohibitin-2; REA; repressor of estrogen receptor activity.

Gene ID

11331

Accession Number

NP_001138303

Reactivity

Homo sapiens|Human

Target

Acts as a mediator of transcriptional repression by nuclear hormone receptors via recruitment of histone deacetylases (By similarity) . Functions as an estrogen receptor (ER) -selective coregulator that potentiates the inhibitory activities of antiestrogens and represses the activity of estrogens. Competes with NCOA1 for modulation of ER transcriptional activity. Probably involved in regulating mitochondrial respiration activity and in aging.

Type

Protein

Source

E.coli

Sequence

MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQDTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILDDVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGEALSKNPGYIKLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.