Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CCND3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Cyclin D3

Gene Aliases

D3-type cyclin; G1/S-specific cyclin-D3.

Gene ID

896

Accession Number

NP_001129489

Reactivity

Homo sapiens|Human

Target

Regulatory component of the cyclin D3-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G (1) /S transition. Phosphorylation of RB1 allows dissociation of the transcription factor E2F from the RB/E2F complex and the subsequent transcription of E2F target genes which are responsible for the progression through the G (1) phase. Hypophosphorylates RB1 in early G (1) phase. Cyclin D-CDK4 complexes are major integrators of various mitogenenic and antimitogenic signals. Also substrate for SMAD3, phosphorylating SMAD3 in a cell-cycle-dependent manner and repressing its transcriptional activity. Component of the ternary complex, cyclin D3/CDK4/CDKN1B, required for nuclear translocation and activity of the cyclin D-CDK4 complex.

Type

Protein

Source

E.coli

Sequence

MELLCCEGTRHAPRAGPDPRLLGDQRVLQSLLRLEERYVPRASYFQCVQREIKPHMRKMLAYWMLEVCEEQRCEEEVFPLAMNYLDRYLSCVPTRKAQLQLLGAVCMLLASKLRETTPLTIEKLCIYTDHAVSPRQLRDWEVLVLGKLKWDLAAVIAHDFLAFILHRLSLPRDRQALVKKHAQTFLALCATDYTFAMYPPSMIATGSIGAAVQGLGACSMSGDELTELLAGITGTEVDCLRACQEQIEAALRESLREASQTSSSPAPKAPRGSSSQGPSQTSTPTDVTAIHL

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

59.5 kDa

Protein Length

Recombinant

NCBI Gene Symbol

CCND3

Protein Name

G1/S-specific cyclin-D3

Gene Name URL

CCND3

Nucleotide Accession Number

NM_001136017

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NME7 Rabbit pAb
E2821040 100 µL

NME7 Rabbit pAb

Sign In for Pricing
View Details
CLINT1 (NM_014666) Human Over-expression Lysate
LS009685 100 µg

CLINT1 (NM_014666) Human Over-expression Lysate

Sign In for Pricing
View Details
CamL (NM_007596) Mouse Untagged Clone
MC200391 10 µg

CamL (NM_007596) Mouse Untagged Clone

Sign In for Pricing
View Details
Luciferase mouse Monoclonal Antibody (7C9)
RA11634-01 50 µL

Luciferase mouse Monoclonal Antibody (7C9)

Sign In for Pricing
View Details
Luciferase mouse Monoclonal Antibody (7C9)
RA11634-02 100 µL

Luciferase mouse Monoclonal Antibody (7C9)

Sign In for Pricing
View Details
Lentiviral mouse Adam5 shRNA (UAS) - Lentiviral mouse Adam5 shRNA (UAS, iRFP) plasmid
GTR15107992 1 Vial

Lentiviral mouse Adam5 shRNA (UAS) - Lentiviral mouse Adam5 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details