Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

C14ORF166 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

RNA transcription, translation and transport factor

Gene Aliases

C14orf166; CGI99; CGI-99; CLE; CLE7; CLE7 homolog; hCLE; hCLE1; LCRP369; RLL motif containing 1; RLLM1; RNA transcription, translation and transport factor protein; UPF0568 protein C14orf166.

Gene ID

51637

Accession Number

NP_057123

Reactivity

Homo sapiens|Human

Target

RNA-binding protein involved in modulation of mRNA transcription by Polymerase II (PubMed:16950395) . Component of the tRNA-splicing ligase complex and is required for tRNA ligation (PubMed:24870230) . May be required for RNA transport (PubMed:24608264) .

Type

Protein

Source

E.coli

Sequence

MFRRKLTALDYHNPAGFNCKDETEFRNFIVWLEDQKIRHYKIEDRGNLRNIHSSDWPKFFEKYLRDVNCPFKIQDRQEAIDWLLGLAVRLEYGDNAEKYKDLVPDNSKTADNATKNAEPLINLDVNNPDFKAGVMALANLLQIQRHDDYLVMLKAIRILVQERLTQDAVAKANQTKEGLPVALDKHILGFDTGDAVLNEAAQILRLLHIEELRELQTKINEAIVAVQAIIADPKTDHRLGKVGR

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

55.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

RTRAF

Protein Name

RNA transcription, translation and transport factor protein

Gene Name URL

RTRAF

Nucleotide Accession Number

NM_016039

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stathmin 1 Phospho-Ser25 (STMN1 pS25) Antibody
abx333240 100 µL

Stathmin 1 Phospho-Ser25 (STMN1 pS25) Antibody

Sign In for Pricing
View Details
SFTPA1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
43607111 3x 1.0 µg

SFTPA1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Bovine Constitutive coactivator of PPAR gamma like protein 1 (FAM120A) ELISA kit
GTR10405131 96 Well

Bovine Constitutive coactivator of PPAR gamma like protein 1 (FAM120A) ELISA kit

Sign In for Pricing
View Details
Mgat4b (BC026638) Mouse Tagged Lenti ORF Clone
MR204107L3 10 µg

Mgat4b (BC026638) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Cadherin 7 (CDH7) (NM_033646) Human Over-expression Lysate
LS001005-100ug 100 µg

Cadherin 7 (CDH7) (NM_033646) Human Over-expression Lysate

Sign In for Pricing
View Details
SDHB Rabbit Polyclonal Antibody
APRab17680-01 20 µL

SDHB Rabbit Polyclonal Antibody

Sign In for Pricing
View Details