Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TAF5L Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

TATA-box binding protein associated factor 5 like

Gene Aliases

PAF65B; PAF65-beta; PCAF-associated factor 65 beta; TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L; TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF) -associated factor, 65kDa.

Gene ID

27097

Accession Number

NP_001020418

Reactivity

Homo sapiens|Human

Target

Functions as a component of the PCAF complex. The PCAF complex is capable of efficiently acetylating histones in a nucleosomal context. The PCAF complex could be considered as the human version of the yeast SAGA complex.

Type

Protein

Source

E.coli

Sequence

MKRVRTEQIQMAVSCYLKRRQYVDSDGPLKQGLRLSQTAEEMAANLTVQSESGCANIVSAAPCQAEPQQYEVQFGRLRNFLTDSDSQHSHEVMPLLYPLFVYLHLNLVQNSPKSTVESFYSRFHGMFLQNASQKDVIEQLQTTQTIQDILSNFKLRAFLDNKYVVRLQEDSYNYLIRYLQSDNNTALCKVLTLHIHLDVQPAKRTDYQLYASGSSSRSENNGLEPPDMPSPILQNEAALEVLQESIKRVKDGPPSLTTICFYAFYNTEQLLNTAEISPDSKLLAAGFDNSCIKLWSLRSKKLKSEPHQVDVSRIHLACDILEEEV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

64 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TAF5L

Protein Name

TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L

Gene Name URL

TAF5L

Nucleotide Accession Number

NM_001025247

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR Blocking Peptide
abx062101-01 1 mg

EGFR Blocking Peptide

Sign In for Pricing
View Details
EGFR Blocking Peptide
abx062101-02 5 mg

EGFR Blocking Peptide

Sign In for Pricing
View Details
Recombinant Rat MYLPF Protein, His (Fc)-Avi-tagged
MYLPF-3519R 50 µg

Recombinant Rat MYLPF Protein, His (Fc)-Avi-tagged

Sign In for Pricing
View Details
Rat Mothers Against Decapentaplegic Homolog 2 (Smad2) ELISA Kit
orb781514-01 48 Tests

Rat Mothers Against Decapentaplegic Homolog 2 (Smad2) ELISA Kit

Sign In for Pricing
View Details
Rat Mothers Against Decapentaplegic Homolog 2 (Smad2) ELISA Kit
orb781514-02 96 Tests

Rat Mothers Against Decapentaplegic Homolog 2 (Smad2) ELISA Kit

Sign In for Pricing
View Details
(E) -KPT330
orb1307341-01 1 mg

(E) -KPT330

Sign In for Pricing
View Details