Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

S100A3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

S100 calcium binding protein A3

Gene Aliases

Protein S100-A3; Protein S-100E; S100 calcium-binding protein A3; S100E.

Gene ID

6274

Accession Number

NP_002951

Reactivity

Homo sapiens|Human

Target

Binds both calcium and zinc. May be involved in calcium-dependent cuticle cell differentiation, hair shaft and hair cuticular barrier formation.

Type

Protein

Source

E.coli

Sequence

ARPLEQAVAAIVCTFQEYAGRCGDKYKLCQAELKELLQKELATWTPTEFRECDYNKFMSVLDTNKDCEVDFVEYVRSLACLCLYCHEYFKDCPSEPPCSQ

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

38.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

S100A3

Protein Name

Protein S100-A3

Gene Name URL

S100A3

Nucleotide Accession Number

NM_002960

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BDP R6G carboxylic acid
T85832-01 1 mg

BDP R6G carboxylic acid

Sign In for Pricing
View Details
BDP R6G carboxylic acid
T85832-02 5 mg

BDP R6G carboxylic acid

Sign In for Pricing
View Details
BDP R6G carboxylic acid
T85832-03 10 mg

BDP R6G carboxylic acid

Sign In for Pricing
View Details
Ccdc132 AAV siRNA Pooled Vector
15196166 1.0 µg

Ccdc132 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
IRAK4, Recombinant, Human (IRAK4, REN64, NY-REN-64, Interleukin-1 receptor-associated kinase 4, IRAK-4 mutated form 1, Interleukin-1 receptor associated kinase 4)
MBS635777-01 0.01 mg

IRAK4, Recombinant, Human (IRAK4, REN64, NY-REN-64, Interleukin-1 receptor-associated kinase 4, IRAK-4 mutated form 1, Interleukin-1 receptor associated kinase 4)

Sign In for Pricing
View Details
IRAK4, Recombinant, Human (IRAK4, REN64, NY-REN-64, Interleukin-1 receptor-associated kinase 4, IRAK-4 mutated form 1, Interleukin-1 receptor associated kinase 4)
MBS635777-02 5x 0.01 mg

IRAK4, Recombinant, Human (IRAK4, REN64, NY-REN-64, Interleukin-1 receptor-associated kinase 4, IRAK-4 mutated form 1, Interleukin-1 receptor associated kinase 4)

Sign In for Pricing
View Details