Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POP7 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

POP7 homolog, ribonuclease P/MRP subunit

Gene Aliases

0610037N12Rik; hPOP7; POP7 (processing of precursor, S. cerevisiae) homolog; processing of precursor 7, ribonuclease P subunit; processing of precursor 7, ribonuclease P/MRP subunit; ribonuclease P protein subunit p20; ribonucleases P/MRP protein subunit POP7 homolog; RNaseP protein p20; RPP2; RPP20.

Gene ID

10248

Accession Number

NP_005828

Reactivity

Homo sapiens|Human

Target

Component of ribonuclease P, a protein complex that generates mature tRNA molecules by cleaving their 5'-ends. Also a component of RNase MRP complex, which cleaves pre-rRNA sequences.

Type

Protein

Source

E.coli

Sequence

MAENREPRGAVEAELDPVEYTLRKRLPSRLPRRPNDIYVNMKTDFKAQLARCQKLLDGGARGQNACSEIYIHGLGLAINRAINIALQLQAGSFGSLQVAANTSTVELVDELEPETDTREPLTRIRNNSAIHIRVFRVTPK

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

POP7

Protein Name

Ribonuclease P protein subunit p20

Gene Name URL

POP7

Nucleotide Accession Number

NM_005837

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SSU72 Protein Vector (Rat) (pPB-N-His)
PV308295 500 ng

SSU72 Protein Vector (Rat) (pPB-N-His)

Sign In for Pricing
View Details
Dichloroprop-2-ethylhexyl ester
sc-234604 250 mg

Dichloroprop-2-ethylhexyl ester

Sign In for Pricing
View Details
Rabbit Polyclonal MEX3A Antibody [mFluor Violet 610 SE]
NBP2-41092MFV610 0.1 mL

Rabbit Polyclonal MEX3A Antibody [mFluor Violet 610 SE]

Sign In for Pricing
View Details
Mov10 RISC Complex RNA Helicase (MOV10) Antibody
abx028426-01 80 µL

Mov10 RISC Complex RNA Helicase (MOV10) Antibody

Sign In for Pricing
View Details
Mov10 RISC Complex RNA Helicase (MOV10) Antibody
abx028426-02 400 µL

Mov10 RISC Complex RNA Helicase (MOV10) Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal METTL7B Antibody [Alexa Fluor 405]
NBP1-77337AF405 0.1 mL

Rabbit Polyclonal METTL7B Antibody [Alexa Fluor 405]

Sign In for Pricing
View Details