What is the catalog number for IRGM Recombinant Protein (Human)?

The catalog number for IRGM Recombinant Protein (Human) is OPCA04829-20UG.

What sizes are available for IRGM Recombinant Protein (Human)?

IRGM Recombinant Protein (Human) is available in the following size(s): 20 µg.

Is IRGM Recombinant Protein (Human) in stock?

IRGM Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

IRGM Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Immunity related GTPase M

Gene Aliases

IFI1; immunity-related GTPase family M protein; Immunity-related GTPase family M protein 1; immunity-related GTPase family, M1; interferon-inducible protein 1; IRGM1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; LRG47; LRG-47; LRG-47-like protein.

Gene ID

345611

Accession Number

NP_001139277

Reactivity

Homo sapiens|Human

Target

Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility (By similarity) .

Type

Protein

Source

E.coli

Sequence

MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.