Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

IRGM Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Immunity related GTPase M

Gene Aliases

IFI1; immunity-related GTPase family M protein; Immunity-related GTPase family M protein 1; immunity-related GTPase family, M1; interferon-inducible protein 1; IRGM1; LPS-stimulated RAW 264.7 macrophage protein 47 homolog; LRG47; LRG-47; LRG-47-like protein.

Gene ID

345611

Accession Number

NP_001139277

Reactivity

Homo sapiens|Human

Target

Putative GTPase which is required for clearance of acute protozoan and bacterial infections. Functions in innate immune response probably through regulation of autophagy. May regulate proinflammatory cytokine production and prevent endotoxemia upon infection. May also play a role in macrophages adhesion and motility (By similarity) .

Type

Protein

Source

E.coli

Sequence

MEAMNVEKASADGNLPEVISNIKETLKIVSRTPVNITMAGDSGNGMSTFISALRNTGHEGKASPPTELVKATQRCASYFSSHFSNVVLWDLPGTGSATTTLENYLMEMQFNRYDFIMVASAQFSMNHVMLAKTAEDMGKKFYIVWTKLDMDLSTGALPEVQLLQIRENVLENLQKERVCEY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.1 kDa

Protein Length

Recombinant

NCBI Gene Symbol

IRGM

Protein Name

Immunity-related GTPase family M protein

Gene Name URL

IRGM

Nucleotide Accession Number

NM_001145805

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PEMT Antibody (FITC)
orb46025-01 50 µg

PEMT Antibody (FITC)

Sign In for Pricing
View Details
PEMT Antibody (FITC)
orb46025-02 100 µg

PEMT Antibody (FITC)

Sign In for Pricing
View Details
Monkey Alpha parvin (PARVA) ELISA Kit
GTR10369954 96 Well

Monkey Alpha parvin (PARVA) ELISA Kit

Sign In for Pricing
View Details
Klhl33 AAV siRNA Pooled Vector
25798164 1.0 µg

Klhl33 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
PRRG1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
37816111 3x 1.0 µg

PRRG1 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Rabbit Polyclonal RNF113A Antibody
NBP1-85378 0.1 mL

Rabbit Polyclonal RNF113A Antibody

Sign In for Pricing
View Details