What is the catalog number for IL37 Recombinant Protein (Human)?

The catalog number for IL37 Recombinant Protein (Human) is OPCA04828-1MG.

What sizes are available for IL37 Recombinant Protein (Human)?

IL37 Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is IL37 Recombinant Protein (Human) in stock?

IL37 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

IL37 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Interleukin 37

Gene Aliases

FIL1; FIL1 zeta; FIL1 (ZETA) ; FIL1Z; IL-1 zeta; IL1F7; IL-1F7; IL1F7 (canonical product IL-1F7b) ; IL-1F7b (IL-1H4, IL-1H, IL-1RP1) ; IL-1H; IL1H4; IL-1H4; IL1RP1; IL-1RP1; IL-1X; IL-1X protein; IL-23; IL-37; interleukin 1 family member 7; interleukin 1, zeta; Interleukin-1 family member 7; interleukin-1 homolog 4; interleukin-1 superfamily z; Interleukin-1 zeta; interleukin-1-related protein; interleukin-23; interleukin-37.

Gene ID

27178

Accession Number

NP_055254

Reactivity

Homo sapiens|Human

Target

Suppressor of innate inflammatory and immune responses involved in curbing excessive inflammation. This function requires SMAD3. Suppresses, or reduces, proinflammatory cytokine production, including IL1A and IL6, as well as CCL12, CSF1, CSF2, CXCL13, IL1B, IL23A and IL1RN, but spares anti-inflammatory cytokines. Inhibits dendritic cell activation.

Type

Protein

Source

E.coli

Sequence

MSFVGENSGVKMGSEDWEKDEPQCCLEDPAGSPLEPGPSLPTMNFVHTSPKVKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAAQKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.