What is the catalog number for DEFB4A Recombinant Protein (Human)?

The catalog number for DEFB4A Recombinant Protein (Human) is OPCA04824-1MG.

What sizes are available for DEFB4A Recombinant Protein (Human)?

DEFB4A Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is DEFB4A Recombinant Protein (Human) in stock?

DEFB4A Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

DEFB4A Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Defensin beta 4A|defensin beta 4B

Gene Aliases

BD-2; beta defensin 2; beta defensin-2; Beta-defensin 2; beta-defensin 4A; beta-defensin 4B; DEFB102; DEFB2; DEFB-2; DEFB4; DEFB4P; defensin, beta 2; defensin, beta 4; defensin, beta 4, pseudogene; HBD-2; SAP1; skin-antimicrobial peptide 1.

Gene ID

100289462|1673

Accession Number

NP_001192195

Reactivity

Homo sapiens|Human

Target

Exhibits antimicrobial activity against Gram-negative bacteria and Gram-positive bacteria. May act as a ligand for C-C chemokine receptor CCR6. Can bind to both human and mouse CCR6 and induce chemotactic activity of CCR6-expressing cells (PubMed:20068036) .

Type

Protein

Source

E.coli

Sequence

MRVLYLLFSFLFIFLMPLPGVFGGIGDPVTCLKSGAICHPVFCPRRYKQIGTCGLPGTKCCKKP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.