Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

BOLL Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Boule homolog, RNA binding protein

Gene Aliases

Bol, boule-like; BOULE; boule-like RNA binding protein; protein boule-like.

Gene ID

66037

Accession Number

NP_001271287

Reactivity

Homo sapiens|Human

Target

Probable RNA-binding protein, which may be required during spermatogenesis. May act by binding to the 3'-UTR of mRNAs and regulating their translation (By similarity) .

Type

Protein

Source

E.coli

Sequence

MQTDSLSPSPNPVSPVPLNNPTSAPRYGTVIPNRIFVGGIDFKTNESDLRKFFSQYGSVKEVKIVNDRAGVSKGYGFVTFETQEDAQKILQEAEKLNYKDKKLNIGPAIRKQQVGIPRSSIMPAAGTMYLTTSTGYPYTYHNGVAYFHTPEVTSVPPPWPSRSVCSSPVMVAQPIYQQPAYHYQATTQYLPGQWQWSVPQPSASSAPFLYLQPSEVIYQPVEIAQDGGCVPPPLSLMETSVPEPYSDHGVQATYHQVYAPSAITMPAPVMQPEPIKTVWSIHY

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

58.3 kDa

Protein Length

Recombinant

NCBI Gene Symbol

BOLL

Protein Name

Protein boule-like

Gene Name URL

BOLL

Nucleotide Accession Number

NM_001284358

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Iso-Gold™ Rapid Mouse-Monoclonal Isotyping κ & λ Kit, 5 tests
KSOT03-005 5 Tests

Iso-Gold™ Rapid Mouse-Monoclonal Isotyping κ & λ Kit, 5 tests

Sign In for Pricing
View Details
PerCP/Fire™ 806 anti-mouse/human CD11b
GT00408 100 µg

PerCP/Fire™ 806 anti-mouse/human CD11b

Sign In for Pricing
View Details
APC-Cy7 anti-human CD294 (CRTH2)
E16FHO294-100 100 Tests

APC-Cy7 anti-human CD294 (CRTH2)

Sign In for Pricing
View Details
Lentiviral human YLPM1 shRNA (UAS) - Lentiviral human YLPM1 shRNA (UAS, GFP) (100)
GTR15316428 1 Vial

Lentiviral human YLPM1 shRNA (UAS) - Lentiviral human YLPM1 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
C5orf23 Human shRNA Plasmid Kit (Locus ID 79614)
TR317467 1 Kit

C5orf23 Human shRNA Plasmid Kit (Locus ID 79614)

Sign In for Pricing
View Details
ERCC1, CT (ERCC1, DNA excision repair protein ERCC-1) (Biotin) discontinued
035194-Biotin 200 µL

ERCC1, CT (ERCC1, DNA excision repair protein ERCC-1) (Biotin) discontinued

Sign In for Pricing
View Details