Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ATP5J Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

ATP synthase peripheral stalk subunit F6

Gene Aliases

ATP synthase subunit h; ATP synthase, H+ transporting, mitochondrial F0 complex, subunit F6; ATP synthase, H+ transporting, mitochondrial Fo complex subunit F6; ATP synthase-coupling factor 6, mitochondrial; ATP5; ATP5A; ATP5J; ATPase subunit F6; ATPM; CF6; coupling factor 6; F6; mitochondrial ATP synthase, coupling factor 6; mitochondrial ATP synthase, subunit F6; mitochondrial ATPase coupling factor 6; proliferation-inducing protein 36.

Gene ID

522

Accession Number

NP_001003696

Reactivity

Homo sapiens|Human

Target

Mitochondrial membrane ATP synthase (F (1) F (0) ATP synthase or Complex V) produces ATP from ADP in the presence of a proton gradient across the membrane which is generated by electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains, F (1) - containing the extramembraneous catalytic core and F (0) - containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F (1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. Part of the complex F (0) domain and the peripheric stalk, which acts as a stator to hold the catalytic alpha (3) beta (3) subcomplex and subunit a/ATP6 static relative to the rotary elements. Also involved in the restoration of oligomycin-sensitive ATPase activity to depleted F1-F0 complexes.

Type

Protein

Source

E.coli

Sequence

NKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQELERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

36 kda

Protein Length

Recombinant

NCBI Gene Symbol

ATP5PF

Protein Name

ATP synthase-coupling factor 6, mitochondrial

Gene Name URL

ATP5PF

Nucleotide Accession Number

NM_001003696

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RPL21P78 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
41084061 1.0 µg DNA

RPL21P78 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
TXNRD1 Rabbit Polyclonal Antibody (BF488)
orb2384999 100 µL

TXNRD1 Rabbit Polyclonal Antibody (BF488)

Sign In for Pricing
View Details
CGAS Knockout 786-O Polyclonal Cells
ARG4946 1 Million

CGAS Knockout 786-O Polyclonal Cells

Sign In for Pricing
View Details
Putative peptide YY-2
AP87530-01 50 µg

Putative peptide YY-2

Sign In for Pricing
View Details
Putative peptide YY-2
AP87530-02 100 µg

Putative peptide YY-2

Sign In for Pricing
View Details
Putative peptide YY-2
AP87530-03 1 mg

Putative peptide YY-2

Sign In for Pricing
View Details