Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ANXA8L1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Annexin A8 like 1

Gene Aliases

Annexin A8L2; annexin A8-like protein 1; annexin A8-like protein 2; annexin VIII; annexin-8; ANXA8; ANXA8L2; bA145E20.2; VAC-beta; vascular anticoagulant-beta.

Gene ID

728113

Accession Number

NP_001092315

Reactivity

Homo sapiens|Human

Type

Protein

Source

E.coli

Sequence

MAWWKAWIEQEGVTVKSSSHFNPDPDAETLYKAMKGIGVGSQLLSHQAAAFAFPSSALTSVSPWGQQGHLCCNPAGTNEQAIIDVLTKRSNTQRQQIAKSFKAQFGKDLTETLKSELSGKFERLIVALMYPPYRYEAKELHDAMKGSRDDVSSFVDPALALQDAQDLYAAGEKIRGTDEMKFITILCTRSATHLLRVKCTQNLHSYFAERLYYAMKGAGTRDGTLIRNIVSRSEIDLNLIKCHFKKMYGKTLSSMIMEDTSGDYKNALLSLVGSDP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

57.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

ANXA8L1

Protein Name

Annexin A8-like protein 1

Gene Name URL

ANXA8L1

Nucleotide Accession Number

NM_001098845

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human SGPP2 Protein, N-His-KSI
E55P7938 50 µg

Recombinant Human SGPP2 Protein, N-His-KSI

Sign In for Pricing
View Details
RNF113B Polyclonal Antibody
BT-AP07951-01 20 µL

RNF113B Polyclonal Antibody

Sign In for Pricing
View Details
RNF113B Polyclonal Antibody
BT-AP07951-02 50 µL

RNF113B Polyclonal Antibody

Sign In for Pricing
View Details
RNF113B Polyclonal Antibody
BT-AP07951-03 100 µL

RNF113B Polyclonal Antibody

Sign In for Pricing
View Details
TCEAL1 (Transcription Elongation Factor A Protein-like 1, TCEA-like Protein 1, pp21, Nuclear Phosphoprotein p21/SIIR, SIIR, Transcription Elongation Factor S-II Protein-like 1) (MaxLight 490)
134280-ML490 100 µL

TCEAL1 (Transcription Elongation Factor A Protein-like 1, TCEA-like Protein 1, pp21, Nuclear Phosphoprotein p21/SIIR, SIIR, Transcription Elongation Factor S-II Protein-like 1) (MaxLight 490)

Sign In for Pricing
View Details
Porcine Olfactory receptor 10A5 (OR10A5) ELISA Kit
MBS7225171-01 48 Well

Porcine Olfactory receptor 10A5 (OR10A5) ELISA Kit

Sign In for Pricing
View Details