Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIAF1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

TGFB1-induced anti-apoptotic factor 1

Gene Aliases

12 kDa TGF-beta-1-induced antiapoptotic factor; MAJN; molecule associated with Jak-3 N-terminal; SPR210; TGFB1-induced anti-apoptotic factor 1; TGF-beta-1-induced antiapoptotic factor 1.

Gene ID

9220

Accession Number

NP_004731

Reactivity

Homo sapiens|Human

Target

Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.

Type

Protein

Source

E.coli

Sequence

MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TIAF1

Protein Name

TGFB1-induced anti-apoptotic factor 1

Gene Name URL

TIAF1

Nucleotide Accession Number

NM_004740

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (Acetyl Lys370) Polyclonal Antibody
E20-40035 100 µg

P53 (Acetyl Lys370) Polyclonal Antibody

Sign In for Pricing
View Details
SKP1 Polyclonal Antibody
E912518 100 µL

SKP1 Polyclonal Antibody

Sign In for Pricing
View Details
MET, Phosphorylated (Y1003) (Hepatocyte Growth Factor Receptor, HGF, AUTS9, Scatter Factor Receptor, HGFR, RCCP2, c-MET) (APC)
MBS6426563-01 0.1 mL

MET, Phosphorylated (Y1003) (Hepatocyte Growth Factor Receptor, HGF, AUTS9, Scatter Factor Receptor, HGFR, RCCP2, c-MET) (APC)

Sign In for Pricing
View Details
MET, Phosphorylated (Y1003) (Hepatocyte Growth Factor Receptor, HGF, AUTS9, Scatter Factor Receptor, HGFR, RCCP2, c-MET) (APC)
MBS6426563-02 5x 0.1 mL

MET, Phosphorylated (Y1003) (Hepatocyte Growth Factor Receptor, HGF, AUTS9, Scatter Factor Receptor, HGFR, RCCP2, c-MET) (APC)

Sign In for Pricing
View Details
Na-Fmoc-Nd-Boc-L-ornithine 4-alkoxybenzyl alcohol resin
240559-01 1 g

Na-Fmoc-Nd-Boc-L-ornithine 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details
Na-Fmoc-Nd-Boc-L-ornithine 4-alkoxybenzyl alcohol resin
240559-02 5 g

Na-Fmoc-Nd-Boc-L-ornithine 4-alkoxybenzyl alcohol resin

Sign In for Pricing
View Details