Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

TIAF1 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

TGFB1-induced anti-apoptotic factor 1

Gene Aliases

12 kDa TGF-beta-1-induced antiapoptotic factor; MAJN; molecule associated with Jak-3 N-terminal; SPR210; TGFB1-induced anti-apoptotic factor 1; TGF-beta-1-induced antiapoptotic factor 1.

Gene ID

9220

Accession Number

NP_004731

Reactivity

Homo sapiens|Human

Target

Inhibits the cytotoxic effects of TNF-alpha and overexpressed TNF receptor adapters TRADD, FADD, and RIPK1. Involved in TGF-beta1 inhibition of IkappaB-alpha expression and suppression of TNF-mediated IkappaB-alpha degradation.

Type

Protein

Source

E.coli

Sequence

MSSPSSPFREQSFLCAAGDAGEESRVQVLKNEVRRGSPVLLGWVEQAYADKCVCGPSAPPAPTPPSLSQRVMCNDLFKVNPFQLQQFRADPSTASLLLCPGGLDHKLNLRGKAWG

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

39.4 kDa

Protein Length

Recombinant

NCBI Gene Symbol

TIAF1

Protein Name

TGFB1-induced anti-apoptotic factor 1

Gene Name URL

TIAF1

Nucleotide Accession Number

NM_004740

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human cTnI (86-90 aa) Matched Antibody Pair Set [Z01LS-0722-LS298]
Z01LS-0722-LS298 5 Plates

Human cTnI (86-90 aa) Matched Antibody Pair Set [Z01LS-0722-LS298]

Sign In for Pricing
View Details
IDH2 (B-6) Alexa Fluor® 680
sc-374476 AF680 200 µg/mL

IDH2 (B-6) Alexa Fluor® 680

Sign In for Pricing
View Details
Gm5515 3'UTR GFP Stable Cell Line
TU158237 1.0 mL

Gm5515 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Vom2r57 (NM_001099474) Rat Tagged ORF Clone
RR208177 10 µg

Vom2r57 (NM_001099474) Rat Tagged ORF Clone

Sign In for Pricing
View Details
L2hgdh siRNA Oligos set (Mouse)
26250174 3x 5 nmol

L2hgdh siRNA Oligos set (Mouse)

Sign In for Pricing
View Details
KLF12 Polyclonal Antibody
MBS9245736-01 0.1 mL

KLF12 Polyclonal Antibody

Sign In for Pricing
View Details