What is the catalog number for SOCS2 Recombinant Protein (Human)?

The catalog number for SOCS2 Recombinant Protein (Human) is OPCA04795-1MG.

What sizes are available for SOCS2 Recombinant Protein (Human)?

SOCS2 Recombinant Protein (Human) is available in the following size(s): 1 mg.

Is SOCS2 Recombinant Protein (Human) in stock?

SOCS2 Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

SOCS2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Suppressor of cytokine signaling 2

Gene Aliases

CIS2; CIS-2; Cish2; cytokine-inducible SH2 protein 2; SOCS-2; SSI2; SSI-2; STATI2; STAT-induced STAT inhibitor 2; suppressor of cytokine signaling 2.

Gene ID

8835

Accession Number

NP_001257396

Reactivity

Homo sapiens|Human

Target

SOCS family proteins form part of a classical negative feedback system that regulates cytokine signal transduction. SOCS2 appears to be a negative regulator in the growth hormone/IGF1 signaling pathway. Probable substrate recognition component of a SCF-like ECS (Elongin BC-CUL2/5-SOCS-box protein) E3 ubiquitin-protein ligase complex which mediates the ubiquitination and subsequent proteasomal degradation of target proteins.

Type

Protein

Source

E.coli

Sequence

MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.