What is the catalog number for POLR1D Recombinant Protein (Human)?

The catalog number for POLR1D Recombinant Protein (Human) is OPCA04789-100UG.

What sizes are available for POLR1D Recombinant Protein (Human)?

POLR1D Recombinant Protein (Human) is available in the following size(s): 100 µg.

Is POLR1D Recombinant Protein (Human) in stock?

POLR1D Recombinant Protein (Human) is currently made to order / not held in immediate stock. Contact us for lead time.

POLR1D Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

RNA polymerase I and III subunit D

Gene Aliases

AC19; DNA-directed RNA polymerase I subunit D; DNA-directed RNA polymerases I and III subunit RPAC2; hRPA19; POLR1C; polymerase (RNA) I polypeptide D, 16kDa; polymerase (RNA) I subunit D; Protein POLR1D; RNA polymerase I 16 kDa subunit; RNA polymerase I subunit D; RNA polymerases I and III subunit AC2; RPA16; RPA9; RPAC2; RPC16; RPO1-3; TCS2.

Gene ID

51082

Accession Number

NP_001193488

Reactivity

Homo sapiens|Human

Target

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.

Type

Protein

Source

E.coli

Sequence

MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.