Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

POLR1D Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

RNA polymerase I and III subunit D

Gene Aliases

AC19; DNA-directed RNA polymerase I subunit D; DNA-directed RNA polymerases I and III subunit RPAC2; hRPA19; POLR1C; polymerase (RNA) I polypeptide D, 16kDa; polymerase (RNA) I subunit D; Protein POLR1D; RNA polymerase I 16 kDa subunit; RNA polymerase I subunit D; RNA polymerases I and III subunit AC2; RPA16; RPA9; RPAC2; RPC16; RPO1-3; TCS2.

Gene ID

51082

Accession Number

NP_001193488

Reactivity

Homo sapiens|Human

Target

DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Common core component of RNA polymerases I and III which synthesize ribosomal RNA precursors and small RNAs, such as 5S rRNA and tRNAs, respectively.

Type

Protein

Source

E.coli

Sequence

MEEDQELERKISGLKTSMAEGERKTALEMVQAAGTDRHCVTFVLHEEDHTLGNSLRYMIMKNPEVEFCGYTTTHPSESKINLRIQTRGTLPAVEPFQRGLNELMNVCQHVLDKFEASIKDYKDQKASRNESTF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

42.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

POLR1D

Protein Name

DNA-directed RNA polymerases I and III subunit RPAC2|Protein POLR1D, isoform 2

Gene Name URL

POLR1D

Nucleotide Accession Number

NM_001206559

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GIPC2 Protein
ARP2243-01 10 µg

Recombinant Human GIPC2 Protein

Sign In for Pricing
View Details
Recombinant Human GIPC2 Protein
ARP2243-02 50 µg

Recombinant Human GIPC2 Protein

Sign In for Pricing
View Details
Recombinant Human GIPC2 Protein
ARP2243-03 100 µg

Recombinant Human GIPC2 Protein

Sign In for Pricing
View Details
Recombinant Human GIPC2 Protein
ARP2243-04 1 mg

Recombinant Human GIPC2 Protein

Sign In for Pricing
View Details
GLB1L Human Gene Knockout Kit (CRISPR)
KN413612 1 Kit

GLB1L Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
ZNF669 Antibody
GWB-MM266E 50 µg

ZNF669 Antibody

Sign In for Pricing
View Details