Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

LAMTOR3 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Late endosomal/lysosomal adaptor, MAPK and MTOR activator 3

Gene Aliases

Late endosomal/lysosomal adaptor and MAPK and MTOR activator 3; MAP2K1IP1; MAPBP; MAPK scaffold protein 1; MAPKSP1; MEK binding partner 1; MEK-binding partner 1; mitogen-activated protein kinase kinase 1 interacting protein 1; Mitogen-activated protein kinase kinase 1-interacting protein 1; mitogen-activated protein kinase scaffold protein 1; MP1; PRO0633; ragulator complex protein LAMTOR3; Ragulator3.

Gene ID

8649

Accession Number

NP_001230665

Reactivity

Homo sapiens|Human

Target

As part of the Ragulator complex it is involved in amino acid sensing and activation of mTORC1, a signaling complex promoting cell growth in response to growth factors, energy levels, and amino acids. Activated by amino acids through a mechanism involving the lysosomal V-ATPase, the Ragulator functions as a guanine nucleotide exchange factor activating the small GTPases Rag. Activated Ragulator and Rag GTPases function as a scaffold recruiting mTORC1 to lysosomes where it is in turn activated. Adapter protein that enhances the efficiency of the MAP kinase cascade facilitating the activation of MAPK2.

Type

Protein

Source

E.coli

Sequence

MADDLKRFLYKKLPSVEGLHAIVVSDRDGVPVIKVANDNAPEHALRPGFLSTFALATDQGSKLGLSKNKSIICYYNTYQVVQFNRLPLVVSFIASSSANTGLIVSLEKELAPLFEELRQVVEVS

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

40.6 kDa

Protein Length

Recombinant

NCBI Gene Symbol

LAMTOR3

Protein Name

Ragulator complex protein LAMTOR3

Gene Name URL

LAMTOR3

Nucleotide Accession Number

NM_001243736

More Discoveries

Explore Other Products

Browse additional items from our catalog

mSin3A (SIN3A) Human siRNA Oligo Duplex (Locus ID 25942)
SR323727 1 Kit

mSin3A (SIN3A) Human siRNA Oligo Duplex (Locus ID 25942)

Sign In for Pricing
View Details
Recombinant Human GGT5 Protein, N-His
YHE17101 100 μg

Recombinant Human GGT5 Protein, N-His

Sign In for Pricing
View Details
Recombinant Pongo abelii GDP-L-fucose synthase (TSTA3)
MBS1463820-01 0.02 mg (E-Coli)

Recombinant Pongo abelii GDP-L-fucose synthase (TSTA3)

Sign In for Pricing
View Details
Recombinant Pongo abelii GDP-L-fucose synthase (TSTA3)
MBS1463820-02 0.02 mg (Yeast)

Recombinant Pongo abelii GDP-L-fucose synthase (TSTA3)

Sign In for Pricing
View Details
Recombinant Pongo abelii GDP-L-fucose synthase (TSTA3)
MBS1463820-03 0.1 mg (E-Coli)

Recombinant Pongo abelii GDP-L-fucose synthase (TSTA3)

Sign In for Pricing
View Details
Recombinant Pongo abelii GDP-L-fucose synthase (TSTA3)
MBS1463820-04 0.1 mg (Yeast)

Recombinant Pongo abelii GDP-L-fucose synthase (TSTA3)

Sign In for Pricing
View Details