Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

HSPB2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Heat shock protein family B (small) member 2

Gene Aliases

DMPK-binding protein; heat shock 27kDa protein 2; heat shock protein beta-2; heat-shock protein beta-2; Hs.78846; HSP27; LOH11CR1K; MKBP.

Gene ID

3316

Accession Number

NP_001532

Reactivity

Homo sapiens|Human

Target

May regulate the kinase DMPK.

Type

Protein

Source

E.coli

Sequence

MSGRSVPHAHPATAEYEFANPSRLGEQRFGEGLLPEEILTPTLYHGYYVRPRAAPAGEGSRAGASELRLSEGKFQAFLDVSHFTPDEVTVRTVDNLLEVSARHPQRLDRHGFVSREFCRTYVLPADVDPWRVRAALSHDGILNLEAPRGGRHLDTEVNEVYISLLPAPPDPEEEEEAAIVEP

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

47.2 kDa

Protein Length

Recombinant

NCBI Gene Symbol

HSPB2

Protein Name

Heat shock protein beta-2

Gene Name URL

HSPB2

Nucleotide Accession Number

NM_001541

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)
MBS1063365-01 0.02 mg (E-Coli)

Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)
MBS1063365-02 0.1 mg (E-Coli)

Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)
MBS1063365-03 0.02 mg (Yeast)

Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)
MBS1063365-04 0.1 mg (Yeast)

Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)
MBS1063365-05 0.02 mg (Baculovirus)

Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details
Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)
MBS1063365-06 0.02 mg (Mammalian-Cell)

Recombinant Desulfovibrio vulgaris subsp. vulgaris Probable GTP-binding protein EngB (engB)

Sign In for Pricing
View Details