Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

GSTA2 Recombinant Protein (Human)

Product Specifications

CAS Number

9000-83-3

Gene Name

Glutathione S-transferase alpha 2

Gene Aliases

Glutathione S-alkyltransferase A2; glutathione S-aralkyltransferase A2; glutathione S-aryltransferase A2; glutathione S-transferase A2; GST class-alpha member 2; GST HA subunit 2; GST2; GSTA2-2; GST-gamma; GTA2; GTH2; liver GST2; S- (hydroxyalkyl) glutathione lyase A2; testis tissue sperm-binding protein Li 59n.

Gene ID

2939

Accession Number

NP_000837

Reactivity

Homo sapiens|Human

Target

Conjugation of reduced glutathione to a wide number of exogenous and endogenous hydrophobic electrophiles.

Type

Protein

Source

E.coli

Sequence

MAEKPKLHYSNIRGRMESIRWLLAAAGVEFEEKFIKSAEDLDKLRNDGYLMFQQVPMVEIDGMKLVQTRAILNYIASKYNLYGKDIKEKALIDMYIEGIADLGEMILLLPFTQPEEQDAKLALIQEKTKNRYFPAFEKVLKSHGQDYLVGNKLSRADIHLVELLYYVEELDSSLISSFPLLKALKTRISNLPTVKKFLQPGSPRKPPMDEKSLEESRKIFRF

Assay Protocol

Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Reconstitution & Storage Instructions Reconstitution & Storage Instructions Western Blotting/Immunoblotting (WB/IB) Protocol Western Blotting/Immunoblotting (WB/IB) Protocol Immunohistochemistry (IHC) Protocol Immunohistochemistry (IHC) Protocol Immunocytochemistry (ICC) Protocol Immunocytochemistry (ICC) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol Blocking Peptide Competition Protocol (BPCP) Blocking Peptide Competition Protocol (BPCP) Immunoprecipitation (IP) Protocol Immunoprecipitation (IP) Protocol Antibody Array (AA) Protocol Antibody Array (AA) Protocol

Format

Liquid or Lyophilized powder

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

-20°C or -80°C

Molecular Weight

52.7 kDa

Protein Length

Recombinant

NCBI Gene Symbol

GSTA2

Protein Name

Glutathione S-transferase A2

Gene Name URL

GSTA2

Nucleotide Accession Number

NM_000846

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Osteopontin, CT (Bone Sialoprotein 1, Nephropontin, Secreted Phosphoprotein 1, SPP-1, Urinary Stone Protein, Uropontin, SPP1, BNSP, OPN, PSEC0156) (PE)
MBS6129496-01 0.1 mL

Osteopontin, CT (Bone Sialoprotein 1, Nephropontin, Secreted Phosphoprotein 1, SPP-1, Urinary Stone Protein, Uropontin, SPP1, BNSP, OPN, PSEC0156) (PE)

Sign In for Pricing
View Details
Osteopontin, CT (Bone Sialoprotein 1, Nephropontin, Secreted Phosphoprotein 1, SPP-1, Urinary Stone Protein, Uropontin, SPP1, BNSP, OPN, PSEC0156) (PE)
MBS6129496-02 5x 0.1 mL

Osteopontin, CT (Bone Sialoprotein 1, Nephropontin, Secreted Phosphoprotein 1, SPP-1, Urinary Stone Protein, Uropontin, SPP1, BNSP, OPN, PSEC0156) (PE)

Sign In for Pricing
View Details
Rabbit anti-Oryza sativa subsp. japonica (Rice) H2B.2 Polyclonal Antibody
MBS7197660 Inquire

Rabbit anti-Oryza sativa subsp. japonica (Rice) H2B.2 Polyclonal Antibody

Sign In for Pricing
View Details
Anti-Junctional Adhesion Molecule 1/JAM-A Rabbit pAb
GB111265-100 100 μL

Anti-Junctional Adhesion Molecule 1/JAM-A Rabbit pAb

Sign In for Pricing
View Details
IDI2 shRNA (h) Lentiviral Particles
sc-90701-V 200 µL

IDI2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details
L-Valine-d8
TRC-V094208-5MG 5 mg

L-Valine-d8

Sign In for Pricing
View Details